KEGG   Bifidobacterium catenulatum: BBCT_0158Help
Entry
BBCT_0158         CDS       T03931                                 

Definition
(GenBank) glutamyl-tRNA synthase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
bcat  Bifidobacterium catenulatum
Pathway
bcat00860  Porphyrin and chlorophyll metabolism
bcat00970  Aminoacyl-tRNA biosynthesis
bcat01100  Metabolic pathways
bcat01110  Biosynthesis of secondary metabolites
bcat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBCT_0158
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBCT_0158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcat01007]
    BBCT_0158
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcat03016]
    BBCT_0158
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bcat02048]
    BBCT_0158
Enzymes [BR:bcat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BBCT_0158
Amino acid related enzymes [BR:bcat01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BBCT_0158
Transfer RNA biogenesis [BR:bcat03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBCT_0158
 Prokaryotic Type
   Other AARSs
    BBCT_0158
Prokaryotic defense system [BR:bcat02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BBCT_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: BAR01126
UniProt: B6XWQ4
Position
214627..216186
Genome map
AA seq 519 aa AA seqDB search
MGGTSGLRGTMESMTEAENTKPELPENVRVRFCPSPTGIPHVGMVRTALFNWAEARHTKG
TFVFRIEDTDAQRDSEESYNQIIEALNWLGIDWDEGINVGGPDGPYRQSERGDIYKDVAA
KLLEAGYAYESFSTPEEIEARNVAAGRPKAFGYDGYDRNLTEEQKAAFRAEGRKPALRIR
MPDEDIAFDDLIRGRIEFKAGSVPDYVIVRPNGDPLYTLTNPVDDAMMNINVVLRGEDLL
SSTPRQIVLYRYLIELGVAKEMPLFGHMPYVMGQGNKKLSKRDPESNLFLHRDNGFIREG
LLNYLALLGWSIAADRDVFSMEEMIEKFDVRDVKANPARFDIDKAISINAEHIRMLEPQD
FLNRAVPYLNRDGVVSADSWDALTDREREVLSASVDLVQSRVRLLGEVAGMVGSLLSTEG
YIEPDDDAKKQLKDSAPAVLDAAIAALSAVDEADWKTDFLHETLNKALIEDGGYKPRLAF
GPVRVAMSGRRVSPPLFESMEIVGKEIAVARLQGLREHL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcacgtccggtttgcggggcacaatggaatctatgactgaagctgaaaatacc
aaaccggaacttcctgagaatgttcgcgtgcgcttctgcccgtctccgaccggcattccg
cacgtcggcatggtccgtaccgcactgttcaactgggctgaggcccgccacaccaagggc
acgttcgtgttccgtattgaagatacggacgctcagcgcgactccgaggaaagctacaac
cagatcatcgaagccctgaactggctgggcatcgactgggatgagggcatcaacgtgggc
ggtcctgacggtccgtaccgccagtccgagcgtggcgacatctacaaggatgtcgcagcc
aagttgctcgaagccggctatgcgtacgaatccttctccactccggaggaaatcgaagcc
cgcaacgtggctgcaggccgcccgaaggcattcggctacgatggttacgaccgcaatctc
accgaagaacagaaggccgctttccgtgcggaaggacgtaagccagccctgcgtatccgc
atgcccgacgaggatatcgcgttcgacgatctgatccgtggccgcatcgaattcaaggcc
ggttccgtgccggattatgtgatcgtgcgcccgaacggcgatccgctgtacacgctgacc
aatccagtcgacgacgccatgatgaatatcaacgtggtgctgcgcggtgaggacctgttg
agctccaccccgcgtcagatcgtgctctaccgttacctgatcgagctgggcgtggccaag
gaaatgccgctgttcggccatatgccttacgtgatgggccagggcaacaagaagctttcc
aagcgcgatccggaatccaacctgttcctgcatcgcgacaacggcttcattcgcgaaggc
ctgctgaactacctggcgctgctgggctggtccatcgccgccgaccgcgacgtgttctct
atggaagagatgatcgagaagttcgacgtgcgtgacgtcaaggccaatccggcccgtttc
gacatcgacaaggccatttccatcaacgccgaacacattcgcatgctcgaaccgcaggac
ttcctgaaccgtgccgtgccgtatctgaaccgtgacggcgtggtttccgccgattcttgg
gatgcgctgaccgaccgtgaacgcgaagtgctgtccgcttccgtggatctcgtgcagtcg
cgcgtgcgcctgttgggcgaggttgcgggcatggtcggctcgctgctctccaccgagggc
tatatcgagcctgacgacgatgccaagaagcagctgaaggattccgctccagcagtgctc
gacgccgcaattgccgcactttccgctgtcgatgaagctgattggaagactgacttcctg
cacgagacgctgaacaaggcgctgatcgaggatggcggttacaagccgcgtctggcattc
ggtcctgtgcgtgtggccatgagcggccgtcgcgtgtctccgccgctgttcgaatccatg
gagatcgtcggcaaggagattgccgtcgctcgcctgcagggtttgcgcgagcacctgtga

DBGET integrated database retrieval system