KEGG   Bifidobacterium catenulatum: BBCT_1687Help
Entry
BBCT_1687         CDS       T03931                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
bcat  Bifidobacterium catenulatum
Pathway
bcat00460  Cyanoamino acid metabolism
bcat00500  Starch and sucrose metabolism
bcat01100  Metabolic pathways
bcat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBCT_1687
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BBCT_1687
Enzymes [BR:bcat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BBCT_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Fn3-like Glyco_hydro_3_C DUF11
Motif
Other DBs
NCBI-ProteinID: BAR02655
UniProt: B6XS54
Position
complement(2049129..2051252)
Genome map
AA seq 707 aa AA seqDB search
MSDQYDTVSLLDGMKEAGLETNADLSKLYTDYRADRPVVAMWSQDWTLPEVPAGQYSDSL
ISDAKSFSDEAVVVITRVGGEGADLPTNMKAETITYKNNSKDYDDFQDGEHFLQLSKTER
DMIDLVTKNFDKVTLVYNGANAFQFDFLSNYPQIKSVLWCPSAGQTGFSVLGDVLAGETN
PSGKTSDAFVKDLTKTPVFNNTDGAAAASSSSVGADGAFIYDNVDDLAAKYTGFTGQETT
VLPSFVNYVEGIYVGYKFYETAADEGLINYDDTVIYPFGYGLSYTSFEQKMGDVFHKDGK
VTFDVTVTNTGDTAGKDVVEVYYNPPYTDGGIEKASKNLVAFEKTGKLEPGASETVKIEF
DDDDMASYDNKDAKAWVLEKGDYAISIQSDSHHVIDSKRINVADTITYDSESNTHNDDQT
VATNQFDYAAGDVTYLSRANHFANYAEATAAPTNFSMSDEVKAAFTNNGNYDPTKYDDDS
DEMPTTGAKNGLRLADMYGKDYDDADWEKLLDQLTFDDMDNLIANGGYGTPAVSSVGKIQ
LTDADGPASLNNNFTGVGSIGFPASTAFACTWNKDLAKQFGEMIGDMAHDMHVAGWYAPA
MNIHRGAFSGRTFEYFSEDSLLSGVMASHEIAGAKEKGVYSFMKHFALNDQETNRTNMVC
TWADEQAIREIYLKPFEMSVKEGGAQAVMSSFNYIGYIPMPVPPTTC
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccagtacgacaccgtttccctgcttgatggcatgaaggaagctggtcttgaa
accaacgccgatctgagcaagctgtacaccgactatcgtgcggaccgtccggttgttgct
atgtggtcccaggattggaccctgcctgaggttccggccggccaatattccgattcgctg
atttctgacgccaagagcttctccgatgaggctgttgtggtgatcacccgtgtcggtggc
gaaggtgctgatctgccgaccaacatgaaggccgaaaccattacctacaagaacaactcc
aaggattatgatgacttccaggatggtgagcacttcctgcagctgagcaagactgagcgc
gacatgattgacttggtcaccaagaacttcgacaaggtcacgctcgtctataacggtgca
aatgctttccagttcgacttcctgagcaactacccgcagatcaagtccgtgttgtggtgc
ccgtctgcaggccagaccggcttctccgtactcggtgacgtgctcgctggcgaaaccaac
ccgtccggcaagacttccgacgcgttcgttaaggatctgaccaagaccccagtgttcaac
aacactgatggcgctgctgctgccagctcgtcttccgttggtgccgatggtgcattcatc
tacgataacgtcgacgatctggctgctaagtacaccggcttcaccggtcaggaaactacc
gtgcttccgtccttcgttaactatgtcgaaggtatttatgtgggctacaagttctatgag
actgcagccgatgaaggtctgatcaactacgatgacacggtcatctatccgttcggttac
ggcttgtcttacaccagctttgagcagaagatgggtgacgttttccacaaggatggcaag
gtcacgtttgatgtgaccgtcaccaacactggcgacaccgccggcaaggacgttgttgag
gtctactacaacccgccgtacaccgatggcggtatcgagaaggcctccaagaacctcgtc
gctttcgagaagaccgggaagcttgagccgggcgcctctgagactgtgaagatcgagttc
gatgatgacgatatggcttcctatgacaacaaggatgccaaggcttgggtgctggagaag
ggtgattacgccatctctatccagtccgattctcaccatgtgatcgattccaagaggatc
aacgttgctgacaccatcacctacgactccgagtcgaacacccacaacgatgatcagacc
gtggctaccaaccagttcgactatgccgctggcgatgtgacctatctgtcccgcgccaat
cacttcgcgaactacgctgaagccaccgcagccccgaccaacttctccatgagcgacgaa
gtcaaggctgctttcaccaacaacggcaactatgatccgaccaagtatgacgatgattcc
gacgaaatgccgaccaccggtgccaagaatggtctccgcttggctgacatgtacggcaag
gattacgacgatgctgattgggagaagctgcttgaccagctgaccttcgatgatatggac
aacctcatcgccaacggtggctacggcaccccggctgtctcctccgttggcaagatccag
ctcaccgatgctgacggtccggcctcgctgaacaacaacttcaccggcgttggctccatc
ggcttcccggcttccaccgcattcgcctgcacttggaacaaggatctggccaagcagttc
ggcgagatgatcggcgacatggctcatgacatgcacgttgctggttggtacgctccggct
atgaacatccaccgtggcgctttctccggccgtaccttcgagtacttctccgaggactcc
ctgctctctggtgttatggcttcccacgagatcgccggcgctaaggagaagggcgtgtat
tccttcatgaagcacttcgctctgaacgatcaggaaaccaaccgtaccaacatggtgtgc
acctgggcggacgagcaggccatccgcgagatctacctcaagccgttcgagatgagcgtg
aaggaaggcggcgcacaggccgtgatgagctccttcaactacatcggttatatacctatg
ccggtgcctccaacaacctgctga

DBGET integrated database retrieval system