KEGG   Bacillus cereus B4264: BCB4264_A0799Help
Entry
BCB4264_A0799     CDS       T00805                                 

Gene name
kdpC
Definition
(GenBank) potassium-transporting ATPase, C subunit
  KO
K01548  potassium-transporting ATPase KdpC subunit
Organism
bcb  Bacillus cereus B4264
Pathway
bcb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCB4264_A0799 (kdpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpC
Motif
Other DBs
NCBI-ProteinID: ACK63260
UniProt: B7HDG0
Position
774688..775269
Genome map
AA seq 193 aa AA seqDB search
MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLI
GQNFTDPRYFQGRVSSIEYKAEASGSNNYAPSNPDLAKRVEKSIADWKEKNPAVPVTEIP
IDLVTNSGSGLDPDISPKAASVQVDRISKLTNIPKEKLNQLIKDQTEGAALGLFGETRVN
VLKLNLALQKLMK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaacaaagtatactatcaccaattatccgtattacttttacatttctagtg
ttgtgtggacttgtatacccacttattgttactggtattgcacaagcagtaatgaaggat
aacgcggatggaagtctaatatataatgataaaaatgaagtgattggttctaaattaatt
ggtcaaaacttcacggatccacgttattttcaagggcgtgtttctagtattgaatataag
gctgaagcatctggttcaaataactatgcaccatctaatccagatttagcaaagcgagta
gagaaaagtattgcggactggaaggaaaaaaatccagctgttccggttacagaaatacca
atagatttagtgacaaattcaggttcagggcttgatcctgatattagtccaaaggcggcc
tcggtgcaggtggatcgcatctcgaaattaacgaatattccgaaagaaaaacttaatcaa
ttgattaaagatcaaacagaaggtgctgcgcttggtttatttggagagacccgcgtaaac
gtcttaaagctaaatttggcattacagaaattaatgaaatag

DBGET integrated database retrieval system