KEGG   Bacillus cereus B4264: BCB4264_A0876Help
Entry
BCB4264_A0876     CDS       T00805                                 

Definition
(GenBank) glucokinase regulator-related protein
  KO
K07106  N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00520  Amino sugar and nucleotide sugar metabolism
bcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BCB4264_A0876
Enzymes [BR:bcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.126  N-acetylmuramic acid 6-phosphate etherase
     BCB4264_A0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2 DUF4388 BAR_3_WASP_bdg
Motif
Other DBs
NCBI-ProteinID: ACK58923
UniProt: B7HER4
Position
843179..844063
Genome map
AA seq 294 aa AA seqDB search
MLENLSTEHRNEKTMNLDEMSIKEVLQSMNEEDRTVALAVEKEIEQIEKVVQTVIKSFEE
EGRLIYIGAGTSGRLGILDAVECPPTFGTDDKMVQGFIAGGLKAFTKAVEGAEDREELAE
EDLKSIGLNEKDTVIGIAASGRTPYVIGGLKYAQSVGASTASISCNKNAEISKYAKLNVE
VETGAEILTGSTRLKAGTAQKLVLNMISTASMIGVGKVYKNLMVDVQSTNEKLVERSKRI
IVEATGASYEVATEYYEKAERNVKAAIVMVLLQCEYGEALEKLKYAKGFVKKAL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaatttatcgacagaacatcgtaatgagaaaacaatgaatctggatgaaatg
agtataaaagaagtgttgcaaagtatgaatgaagaagatcgaactgttgcgttagcagtt
gaaaaagagatagaacaaattgaaaaggttgtacagactgttattaaatcttttgaagaa
gagggacgcttaatttacattggtgctggtacaagtggtcgtttaggtattctagatgca
gtggaatgtccgccgacatttggcacggatgataaaatggtgcaaggatttatagcaggt
ggattgaaagcgtttactaaagcggtggaaggtgccgaagatcgcgaagagttagcggaa
gaagatttaaaaagtattggattaaatgagaaagatacagtgattggaattgctgcaagt
ggcagaactccttacgtaatcggcggcttgaaatacgcacagagcgtaggagcgagtaca
gcgagtatttcttgtaataaaaatgctgaaataagtaaatatgcaaagttaaatgtggaa
gtagagacaggtgcagaaatattaacaggatcaacgcgtttaaaagctggtacagcacaa
aaattagtgctgaatatgatttcaacagcttcgatgattggtgtaggaaaagtatataaa
aacttaatggtagatgttcaatccacaaatgaaaagttagtagaacggtcaaaacgaatt
attgtggaagcaacaggcgctagttatgaagtagcgacagagtattatgaaaaggcagaa
cgtaacgtaaaagctgcaattgttatggtgttgttgcagtgtgaatatggggaagcactg
gagaaactaaaatacgctaaagggtttgtgaagaaagcactataa

DBGET integrated database retrieval system