KEGG   Bacillus cereus B4264: BCB4264_A1925Help
Entry
BCB4264_A1925     CDS       T00805                                 

Definition
(GenBank) amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00330  Arginine and proline metabolism
bcb00360  Phenylalanine metabolism
bcb00380  Tryptophan metabolism
bcb00627  Aminobenzoate degradation
bcb00643  Styrene degradation
bcb01100  Metabolic pathways
bcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BCB4264_A1925
   00360 Phenylalanine metabolism
    BCB4264_A1925
   00380 Tryptophan metabolism
    BCB4264_A1925
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCB4264_A1925
   00643 Styrene degradation
    BCB4264_A1925
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BCB4264_A1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase NUDIX_5 NAPRTase_C
Motif
Other DBs
NCBI-ProteinID: ACK64010
UniProt: B7HIW0
Position
1835575..1837185
Genome map
AA seq 536 aa AA seqDB search
MKKWVKVTLSITGGIVLLACAGGYYVYKNYFPKEPERIVYDKERVLQPIHNQLKGINIEN
VKIKEKEVVNATIDELQKMIDDGKLSYEELTSIYLFRIQEHDQNGITLNSVTEINPNAME
EARKLDQERGRNKNSNLYGIPVVVKDNVQTEKVMPTSAGTYVLKDWIADQDATIVKQLKE
EGAFVLGKANMSEWANYLSFTMPSGYSGKKGQNLNPYGPITFDTSGSSSGSATVVAADFA
PLAIGTETTGSIVAPAAQQSVVGLRPSLGMVSRTGIIPLAETLDTAGPMARTVKDAATLF
NVMIGYDEKDVMTEKMKDKERIDYTKDLSIDGLKGKKIGLLFSVDQQDENRKAVAEKIRK
DLQDAGAILTDNIQLSAEGVDNLQTLEYEFKHNVNDYLSQQKNVPVKSLEEIIAFNKKDS
KRRIKYGQTLIEGSEKSAITKEEFENVVQTSQENARKELDRYLVEKGLDALVMINNDEVL
LSAVAGYPELAVPAGYDKNGEPIGVVFVGKQFGEKELFNIGYAYEQQSKNRKSPSL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatgggtaaaggtaacgctgtctatcactggaggcattgtcttattagcgtgt
gccggcggatattacgtgtataaaaattattttccaaaggaacctgagcgtattgtatat
gataaagaaagagtgctacaaccgatacataatcagcttaaaggaatcaatatagaaaat
gtaaagataaaagaaaaagaagtcgtaaatgcgactatagatgagcttcaaaaaatgatt
gatgatggaaagttgtcatatgaagaattaacgagtatttatctctttagaatacaagaa
catgatcaaaatggaataacattaaattctgttacagagataaatcctaatgcgatggaa
gaagcaagaaagttagatcaagagcgggggagaaacaaaaattcgaatttatatggtatt
cctgtcgttgtaaaagataatgtacagacggaaaaagtgatgccgactagtgcaggaact
tatgtattaaaagattggattgcagatcaagacgcaacaattgtgaagcagttgaaagaa
gaaggagcatttgttttaggaaaagcgaatatgtctgagtgggcgaactatttatctttt
acaatgccaagcgggtatagcgggaagaaaggacaaaatttaaatccgtacggtccgatt
acattcgatacttcaggatcaagttcaggatcggctacagtagttgcagcagattttgcg
ccgcttgcaattggaacagaaacgacgggatcgattgttgcaccagcggcgcagcaatca
gtagttgggttacgtccatctttaggtatggtaagtagaacaggaattattccattagct
gaaactcttgatacagcaggacctatggcaagaacagtaaaagatgcagcaacgctattt
aatgtaatgataggttatgatgaaaaagatgttatgacagaaaaaatgaaagataaagaa
aggattgattatacaaaggatttatcaatagatggattaaaagggaaaaagatagggctt
cttttttctgtagaccaacaagatgaaaatagaaaagcagtagcagaaaaaattagaaaa
gaccttcaagatgcaggtgcgatattaactgataatatccagttaagtgctgagggtgta
gataatttgcaaacattagaatatgagttcaagcataatgtaaacgactatctttcacag
caaaagaatgtaccggtaaaatcgttagaagagattatagcgtttaataaaaaggatagt
aaaagacgaataaaatacggacaaacattaattgaagggtctgaaaaatctgctataacg
aaagaagagtttgaaaacgtagtgcaaacgagtcaagaaaatgcaagaaaagagctagat
aggtatttagtagaaaaaggtttggatgctctagttatgattaataacgatgaagtcctt
ctatcagctgtagctggttatccggaattagcggttcctgctggatatgataaaaatgga
gaaccaatcggtgtagtgtttgtagggaaacagtttggtgaaaaagagcttttcaatatt
ggatatgcgtatgaacagcagtctaaaaatagaaaatcacctagtttataa

DBGET integrated database retrieval system