KEGG   Bacillus cereus B4264: BCB4264_A2248Help
Entry
BCB4264_A2248     CDS       T00805                                 

Definition
(GenBank) putative alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00010  Glycolysis / Gluconeogenesis
bcb00071  Fatty acid degradation
bcb00350  Tyrosine metabolism
bcb00625  Chloroalkane and chloroalkene degradation
bcb00626  Naphthalene degradation
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A2248
  Lipid metabolism
   00071 Fatty acid degradation
    BCB4264_A2248
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCB4264_A2248
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCB4264_A2248
   00626 Naphthalene degradation
    BCB4264_A2248
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCB4264_A2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 TrkA_N 2-Hacid_dh_C Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ACK61719
UniProt: B7H525
Position
2148700..2149737
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVTSLKIGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPSQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQEEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKKHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtggttaataaaaacagcaaagcaaacatcgaagtgattgaaaaagaa
ttacgtccgttacactcaggtgaagcgttagtagatgtagagtattgtggagtgtgccac
actgatttacacgttgcgaatcatgattttggtaacactgatggccgtattcttggtcat
gagggtgtaggtattgttacgaaaatagctgatgatgttacttcactaaagataggtgac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgtgtaactggt
agagaaacattttgccgtgaagttaaaaacgctggttattcagtggatggtggtatggct
gaacaatgtatcgttacagctgattatgcggtaaaagtaccagaaggattagatcctgct
caagcatcatcaattacttgtgctggtgtaactacatataaagctattaaagtatcagat
attaaacctagtcaacctattgtaatctatggctgcggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaatcgcagtagacattaatgacgacaaa
ttagccttagcgaaagaagttggtgctgatatgactatcaatccaatttctcaaggtcct
gctgataaaattgtgcaagaggagtttggtggcgcttatgctgcggtagtaacagcagtc
tctaaagtagcctttaactcagcagttgatgcagtacgtgcttgcggtaaagtagttgca
gtagggctaccagtagaaacaatggacttaaacatcccacgacttgtactggatggaatt
gaagtagttggttctctagttggtactcgtaaagatttggaagaggcgtttatgttcggg
gcagaaggaaaagtagtgccagttgttcaaacttgttctctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaattgattttaaaaaacat
aattgtgattgcaaataa

DBGET integrated database retrieval system