KEGG   Bacillus cereus B4264: BCB4264_A2978Help
Entry
BCB4264_A2978     CDS       T00805                                 

Definition
(GenBank) putative ribose ABC transporter, permease protein
  KO
K10556  AI-2 transport system permease protein
Organism
bcb  Bacillus cereus B4264
Pathway
bcb02010  ABC transporters
bcb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCB4264_A2978
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCB4264_A2978
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcb02000]
    BCB4264_A2978
Transporters [BR:bcb02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   AI-2 transporter
    BCB4264_A2978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ACK62615
UniProt: B7H658
Position
complement(2851266..2852219)
Genome map
AA seq 317 aa AA seqDB search
MKHMLKMHETSIILLLLIYIAIVGMINPSFIQFNSLSLLMKSSVILVVLAIGQSFVLFTK
NIDVSVGSSMGLSAAVCGMMLTNGYSAFLSIFVAIILGAIIGFVNGIGVAKFRVPAIIMT
LGMLGIIRGTMLIFTGGKWIEDIPNDFKQLPSIIILGLPITVWFVLIILLLLYFFLRKVP
LGRYFYAVGDNEDGARLIGIPVNKVKIYAFMISGISAAIAGCIFVMNIGFVPNQTGTGLE
LQVIAAAVLGGIPLKGGTGSLFGAALGALFLETISSSLVFLKIPAFWNNAISGFLLLLII
ILDSVMKKWKAERRMNL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatatgttaaaaatgcatgaaacgtctatcatactgttactactaatttatata
gctattgtaggaatgataaaccctagttttattcaatttaactcgttatctttactgatg
aaatcaagcgttattttagtcgtgctagcaatcggtcaatcgttcgtcttatttacgaaa
aatatagatgtatcagttggttcaagcatggggttaagtgcagcagtttgcggaatgatg
ttaacgaatgggtatagtgcattcttgtcgatatttgtagctattatacttggggctatt
attggtttcgtaaatggtattggagttgcgaagtttcgggtaccagccattattatgaca
ttaggcatgttaggaattattagaggtacaatgttaattttcacaggcgggaagtggatt
gaagatattccaaacgattttaagcagctgccatctatcatcattcttggtttacctata
actgtatggttcgttcttattattttactactactatacttctttttaagaaaagtgcca
ttgggaagatacttttatgcggtaggtgataatgaagatggcgcgaggcttattggtata
cctgttaataaagtgaagatatatgcgtttatgatttcaggcataagcgctgcgatcgct
ggttgcatatttgttatgaatatcggtttcgtgccaaatcaaacaggtacaggattagaa
ttacaagtaatcgcagccgctgtactaggaggaattcccttaaaaggaggaacaggatct
ttatttggagctgcattaggagcgttatttttagaaacaataagtagctcactcgtcttt
ttaaaaataccagcattttggaataatgctatttcaggttttttattattacttatcatc
atattagatagtgttatgaaaaagtggaaggcagaaaggaggatgaatctatga

DBGET integrated database retrieval system