KEGG   Bacillus cereus B4264: BCB4264_A3507Help
Entry
BCB4264_A3507     CDS       T00805                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00010  Glycolysis / Gluconeogenesis
bcb00071  Fatty acid degradation
bcb00350  Tyrosine metabolism
bcb00625  Chloroalkane and chloroalkene degradation
bcb00626  Naphthalene degradation
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A3507
  Lipid metabolism
   00071 Fatty acid degradation
    BCB4264_A3507
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCB4264_A3507
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCB4264_A3507
   00626 Naphthalene degradation
    BCB4264_A3507
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCB4264_A3507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C CMAS ELFV_dehydrog DUF1687
Motif
Other DBs
NCBI-ProteinID: ACK62073
UniProt: B7H8P3
Position
3387409..3388407
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDRYGKVPMRMAEVPTPEINEYEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFSGVITKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMQLQKGQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGA
NLVTSLGADEIINYKTEKFEDILKNYDAVFDTIGGATLEKSFNIIKSGGNIVSVSGMPNA
RFGKEFGSGFFKTLLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKP
VIDRVFPFKDAQKAMEYSESGRAKGKIIVKIK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgataattgatagatatggaaaagtcccaatgcgtatggcagaggtacct
actcctgaaattaatgagtatgaagtgctcgcagaaattcatgcagctagcattaaccca
attgattttaaaatacgcgacggaaaagttaaaatgttactgaaatatgaaatgcctcta
atccttgggaatgacttttccggtgtcatcacgaaggttggatcaaaagtgactcgtttt
aaagtcggtgatgaaatatatgctcgtccaagaaaaaataagattggtactttcgcggag
tatatagccattcatgaagatgatattgctttaaaaccaaaaaatctaagttttgaggaa
gcggcttcgattccactcgttggcttaacttcctatcaagctttacatgacatcatgcaa
ttacaaaaaggacaaaagattttaattcacgctggatccggtggtgttggtactttcgct
attcagctagcaaaaataatgggtgctactgttacaacgactgctagtgaagctggtgca
aatttagtaacgtctcttggcgcagatgaaattattaattacaaaacagaaaaatttgaa
gatatactaaaaaattatgatgcggtatttgatacaatcggcggtgcaacacttgaaaaa
tcattcaatattataaaaagcggaggaaacattgtttccgtttcaggtatgccgaatgct
cgcttcggtaaagaatttggttcaggattctttaaaactctcttattttcattagccagt
aaaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggggatcaattacgtactatcgcaaactatattgaagccggaaaaatcaaaccg
gtaatcgatcgagttttcccttttaaagatgcgcaaaaagcaatggaatattcagagtct
ggaagggcaaaaggaaaaataattgtaaaaattaaataa

DBGET integrated database retrieval system