KEGG   Bacillus cereus B4264: BCB4264_A4477Help
Entry
BCB4264_A4477     CDS       T00805                                 

Definition
(GenBank) putative phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00360  Phenylalanine metabolism
bcb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcb00790  Folate biosynthesis
bcb01100  Metabolic pathways
bcb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BCB4264_A4477
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCB4264_A4477
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCB4264_A4477
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BCB4264_A4477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ACK62879
UniProt: B7HDZ2
Position
4337103..4338857
Genome map
AA seq 584 aa AA seqDB search
MTKKTEIPSHLKPFVSTQHYDQYTPVNHAVWRYIMRQNHSFLKDVAHPAYVNGLQSSGIN
IDAIPKVEEMNECLAPSGWGAVTIDGLIPGVAFFDFQGHGLLPIATDIRKVENIEYTPAP
DIVHEAAGHAPILLDPTYAKYVKRFGQIGAKAFSTKEEHDAFEAVRTLTIVKESPTSTPD
EVKAAENAVIEKQNLVSGLSEAEQISRLFWWTVEYGLIGNIDDPKIYGAGLLSSVGESKH
CLTDAVEKVPFSIEACIGTTYDVTKMQPQLFVCESFEELTDALETFSKTMAFKTGGKEGL
EKAIRSENYATAELNSGLQITGTFSETIENDAGELIYMRTNSPTALALHNKQLANHSTSV
HSDGFGTPIGLLTENIALENCTDEQLQSLGITIGTIAEFTFASGIHVKGTVTDIVKNDKK
IALISFIDCTVTYNARVLFDASWGAFDMAVGSQITSVFPGAADAAAFFPMDEEVHEIPAP
LVLNELERMYQTVRDIRSEGILHDAHIDQLVAIQEVLNKFYAKEWLLRLEVLELLLEHNK
GHETSAALLHQLSTFTTDEAVTRLINNGLALLPVKDVKNDAKIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaacagaaattccatcgcatttaaaaccattcgtatccacacaacattat
gatcaatacacaccggtgaatcacgctgtgtggcgttacattatgagacaaaatcatagc
ttcttaaaagacgttgctcatccagcctatgtgaacggactacaatcatctggtattaat
atagatgcaattccaaaagtagaagaaatgaatgagtgtttggcaccaagtggctggggc
gctgtaacgattgacggacttattcccggcgtagcattcttcgattttcaaggacacgga
ttactaccgatcgcaacagatattcggaaagtagaaaatatcgagtacacaccagctcca
gatatcgtacacgaagccgcaggacacgcaccgattttacttgatcctacatatgcaaaa
tatgtgaaacgttttgggcaaattggtgcaaaagctttctctacaaaagaagaacatgat
gcatttgaagctgttcgtacattaacgatagtgaaagaaagccctacttctactcctgat
gaagttaaggctgctgaaaatgctgtaattgaaaaacaaaacttagtttctggtttatca
gaagctgaacaaatttcacgtcttttctggtggacagtagaatatggattgatcggaaat
atagatgatccaaagatatatggtgctggtctcctttcttctgttggcgaaagcaaacat
tgcttaacagacgctgtagaaaaggttccattttctatcgaagcatgtatagggacaact
tatgacgtaacaaaaatgcaaccacaactatttgtttgtgaatcctttgaagaattaaca
gatgcgcttgaaacattttctaaaacaatggcctttaaaacaggtggaaaagaaggttta
gaaaaagcaattcgctctgagaactatgcaacagctgagctaaatagcggattacaaatt
acaggtacatttagcgagacaattgaaaacgatgcaggtgaattaatttacatgcgaaca
aattcgccaacggcattagcacttcataataaacagttagcgaatcattctacttctgta
cacagtgacggatttggaacaccgattggattactcactgaaaatattgcattagaaaat
tgtacagacgaacaactacaatcattaggaattacaattggaactatcgctgagtttact
tttgcaagtggtattcatgtaaaaggaacagtaacagatattgtaaaaaacgataagaaa
attgctcttatttcctttatcgattgcacagttacttataacgcccgcgttttatttgat
gcttcatggggcgcatttgatatggctgttggctcacaaatcacttcagtattcccaggt
gccgcagatgccgcagcatttttcccaatggatgaagaagttcacgaaattcctgctcca
cttgtactgaatgaacttgaacgtatgtatcaaacagttcgagatattcgaagtgagggg
attttacacgacgcgcatatcgatcaattagtagcaattcaagaagtattaaataaattt
tatgcgaaagaatggttactgcgccttgaagtattagagttacttttagagcataacaaa
gggcatgaaacatcggcagcattactacatcaactttctactttcacaactgacgaagct
gtaacacgccttattaacaatggtcttgcgttacttccagtaaaggatgtgaaaaatgat
gctaagattaactga

DBGET integrated database retrieval system