KEGG   Bacillus cereus B4264: BCB4264_A4869Help
Entry
BCB4264_A4869     CDS       T00805                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCB4264_A4869
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BCB4264_A4869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DUF676 Phage_TAC_10 LCAT PGAP1 Ser_hydrolase Abhydrolase_3 LIDHydrolase Abhydrolase_5 DUF900 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: ACK60287
UniProt: B7H9B9
Position
complement(4713349..4714152)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVEGIILSSPCLGVVT
GPSAPLQFASKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILSYIQSFTEMHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcggaggaagcaaaggctgtcattgttattgtgcacggtgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcatatcggctaccacgtc
gtgatgggggatcttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaactatgggtgaaagaagcaagaaagtataggtta
cctatttttctattcggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagagggtattattttgagttcgccttgtttaggggtagtgact
ggaccctctgctccgcttcaatttgcttcaaaaatattaaatgttgtggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacacgtaaccacgaagtgagagatgca
atggagaatgattctttgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataaaaaaatagatgattttccggatgttccgctcttgcta
atgcaagcttgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcacgagttattaaat
gagtatgagcgtgatgaaattttgagttatattcagtcatttactgaaatgcatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system