KEGG   Bacillus cereus B4264: BCB4264_A5102Help
Entry
BCB4264_A5102     CDS       T00805                                 

Definition
(GenBank) phosphatase,haloacid dehalogenase family
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00627  Aminobenzoate degradation
bcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCB4264_A5102
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BCB4264_A5102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Isochorismatase DUF4332
Motif
Other DBs
NCBI-ProteinID: ACK61052
UniProt: B7HBK6
Position
complement(4915130..4915894)
Genome map
AA seq 254 aa AA seqDB search
MYKGYLIDLDGTMYRGEEQIEEASDFVKALGERGIPYLFVTNNSTRKPEQVAEKLVRFDI
LAKAEQVFTTSMATANFIYERKQDATVYMIGEEGLHDALVEKGFELVDENPDFVVVGLDR
DITYEKLAKACLAVRNGATFISTNGDIAIPTERGLLPGNGSLTSVVAVSTGVDPIFIGKP
ESIIMEQALKVLGIEKNEALMVGDNYDTDILAGINAGMHTLLVHTGVTTVEKLTEYEVQP
TQVVHNLTEWIEKM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggttacttaattgacttagacggtacgatgtatcgcggagaagaacaaatt
gaagaagcaagcgacttcgtaaaagcattaggagagcgcggcattccatatttattcgtt
acgaataactcaactcgcaaaccagaacaagtggcagaaaagcttgttcgtttcgatatt
ctagcgaaagcggagcaagtattcacaacgagtatggcgactgcgaacttcatttatgaa
cgtaaacaagacgcaactgtatatatgattggtgaagaaggcttacacgatgcacttgtg
gaaaaaggatttgaacttgtggatgaaaatcctgatttcgttgttgtgggtttagatcgt
gacatcacatatgaaaaattagcaaaagcgtgtcttgctgtgcgtaatggcgcgacgttt
atttctacaaatggggatattgccattccaactgagcgaggattattaccaggtaacggc
tcattaacatcagttgtagcagtatcaacaggtgtggatccaatctttatcggaaaacca
gaatcaatcattatggaacaagctttaaaagtgcttggcatagaaaaaaatgaagcatta
atggttggggataactacgatacagacattttagcaggaataaatgctggtatgcatacc
cttcttgtccacactggagtcacaactgtggagaagttaacagaatatgaagtacaaccg
acgcaagttgtgcataacttgacggagtggattgagaagatgtaa

DBGET integrated database retrieval system