KEGG   Bacillus cereus B4264: BCB4264_A5456Help
Entry
BCB4264_A5456     CDS       T00805                                 

Gene name
fbp2
Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00010  Glycolysis / Gluconeogenesis
bcb00030  Pentose phosphate pathway
bcb00051  Fructose and mannose metabolism
bcb00680  Methane metabolism
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
Module
bcb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB4264_A5456 (fbp2)
   00030 Pentose phosphate pathway
    BCB4264_A5456 (fbp2)
   00051 Fructose and mannose metabolism
    BCB4264_A5456 (fbp2)
  09102 Energy metabolism
   00680 Methane metabolism
    BCB4264_A5456 (fbp2)
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BCB4264_A5456 (fbp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ACK62303
UniProt: B7HFN1
Position
complement(5247314..5248279)
Genome map
AA seq 321 aa AA seqDB search
MERSLSMELVRVTEAAALSSARWMGRGKKDEADGAATSAMRDVFDTIPMKGTVVIGEGEM
DEAPMLYIGEKLGTGYGPRVDVAVDPLEGTNIVAAGGWNALAVIAIADHGNLLHAPDMYM
DKIAVGPEAVGAVDIDAPIIDNLRAVAKAKNKDIEDVVATVLNRPRHQEIIEEIRKAGAR
IKLINDGDVAGAINTAFDRTGVDILFGSGGAPEGVLAAVALKCLGGEIHGKLLPQNEAEL
ARCKKMGIEDINRILRMEDLVKGDDAIFAATGVTDGELLRGVQFKGSVGTTQSLVMRAKS
GTVRFVDGRHSLNKKPNLVIK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagaagtttatctatggagttagtacgtgtaacagaggctgcagctttatcatca
gcgcgttggatggggcgcgggaaaaaggatgaggcagacggtgcagcaacatcagctatg
cgtgatgtatttgatacaattccgatgaaaggtacagttgtaattggtgaaggtgagatg
gatgaagcaccaatgctatatatcggagagaaattaggtacaggatatggaccacgtgta
gacgttgcggttgatcctttagaagggacaaacatcgtagcagctggtggctggaatgct
cttgctgtcattgcaattgcagaccacggtaatttgttacatgcccctgacatgtacatg
gataaaatcgcggttggcccagaagcagttggggcggtcgacattgatgcgcctattatt
gataacttacgtgcagttgcgaaagcgaaaaataaagatattgaagatgttgtagcgaca
gttttaaatcgtccacgtcatcaagaaattatcgaagaaattcgtaaagctggtgcgcgc
attaaattgattaatgatggagatgtagctggagcgattaatacagcgtttgatcgtaca
ggtgtagatattttatttggatctggtggagcacctgaaggtgtattagcagcagttgct
ttaaaatgtttaggtggagaaattcacggaaaactattgccacaaaacgaagctgaatta
gcacgttgtaaaaaaatgggtatagaagacattaatcgtatccttcgcatggaggactta
gtaaaaggtgacgatgcaatctttgcagcaacaggcgtaacagatggagaactattacgc
ggtgttcaatttaaaggtagcgtaggaacaacgcaatcccttgttatgcgcgcaaaatca
ggcacagttcgcttcgtagatggtcgtcatagcttaaataaaaaaccgaacttggttatt
aagtaa

DBGET integrated database retrieval system