KEGG   Bacillus cereus B4264: BCB4264_A5467Help
Entry
BCB4264_A5467     CDS       T00805                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00071  Fatty acid degradation
bcb00072  Synthesis and degradation of ketone bodies
bcb00280  Valine, leucine and isoleucine degradation
bcb00310  Lysine degradation
bcb00362  Benzoate degradation
bcb00380  Tryptophan metabolism
bcb00620  Pyruvate metabolism
bcb00630  Glyoxylate and dicarboxylate metabolism
bcb00640  Propanoate metabolism
bcb00650  Butanoate metabolism
bcb00900  Terpenoid backbone biosynthesis
bcb01100  Metabolic pathways
bcb01110  Biosynthesis of secondary metabolites
bcb01120  Microbial metabolism in diverse environments
bcb01130  Biosynthesis of antibiotics
bcb01200  Carbon metabolism
bcb01212  Fatty acid metabolism
bcb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCB4264_A5467
   00630 Glyoxylate and dicarboxylate metabolism
    BCB4264_A5467
   00640 Propanoate metabolism
    BCB4264_A5467
   00650 Butanoate metabolism
    BCB4264_A5467
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCB4264_A5467
   00072 Synthesis and degradation of ketone bodies
    BCB4264_A5467
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCB4264_A5467
   00310 Lysine degradation
    BCB4264_A5467
   00380 Tryptophan metabolism
    BCB4264_A5467
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCB4264_A5467
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCB4264_A5467
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCB4264_A5467
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcb04147]
    BCB4264_A5467
Enzymes [BR:bcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCB4264_A5467
Exosome [BR:bcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCB4264_A5467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACK59516
UniProt: B7HFP2
Position
complement(5258727..5260010)
Genome map
AA seq 427 aa AA seqDB search
MYTTLERGAMIAPLLNVGIPSERSVLKNEMGERKMSKTVILSAARTPVGKFGGSLKDVKA
TELGGIAIKAALERANVAASDVEEVIFGTVIQGGQGQIPSRQAARAAGIPWEVQTETVNK
VCASGLRAVTLADQIIRTGDQSLIVAGGMESMSNSPYILRGARWGYRMGNNEVIDLNVAD
GLTCAFSGTHMGVYGGEVAKEDGISREAQDEWAYRSHQRAVSAHKEGRFEEEIVPVTIPQ
RKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTATVTAGNAPGLNDGGAALVLMSEDRAK
QEGRKPLATILAHTAIAVESKDFPRTPGYAINALLEKTGKTIEDIDLFEINEAFAAVAIA
STEIAGIDPEKLNVNGGAVAMGHPIGASGARIIVTLIHALKQRGGGIGIASICSGGGQGD
AVMIEVH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaactttagaaagaggtgcaatgattgcacctcttctcaacgtagggataccg
agcgagcgctcagtgttaaaaaatgaaatgggggaaagaaaaatgagtaaaacagttatt
ttaagtgctgcaagaacaccagttggaaaatttggaggatctttaaaggatgtaaaagcg
acggaacttggaggaattgcaattaaagcagcgcttgaaagagcaaatgttgcggctagt
gatgttgaagaagttatatttggaacggttattcaaggtgggcagggacaaattccatcg
cgccaagctgcgagggctgctggaatcccttgggaagtgcagacggaaacagtgaataaa
gtttgtgcatcagggcttcgtgcggttacgttagcggatcagattattcgtactggcgat
caatcactgattgtagctggcggtatggagtcgatgagtaacagtccttacattttacgt
ggagcaagatggggatacagaatgggcaacaacgaagttattgatttaaacgttgctgac
ggtttaacatgcgcattttcaggtacacacatgggcgtttatggcggagaagttgcaaag
gaagatggaatttctcgcgaagcgcaagatgaatgggcatatcgtagccatcagcgtgcg
gtttcagcgcataaagaagggcgttttgaagaggaaatcgtgccagtaacgattccgcaa
agaaaaggcgatcctattgtcgttgcaaaggatgaggcgccacgtgaagatacaacgatt
gaaaagttagcaaagttaaaacctgtatttgataagacagcgacggtgacagctggtaat
gcaccaggactaaacgatggtggtgccgcacttgtattaatgagcgaagacagagcgaag
caagaaggaagaaagccattagcgacaattttggcgcatacagcaattgcagtggaatct
aaagatttcccaagaactccaggttatgcaattaacgcattgcttgaaaaaacaggaaag
acaattgaagacattgatttattcgagattaatgaagcctttgcagcggtagcaattgca
agtacagaaatcgcaggaattgatccggaaaaattgaatgtaaatggtggcgcggtagcg
atgggacatccaattggagcaagcggagcgcgcattatcgttacactaatccatgcactt
aagcagcgcggcggcggaattggaattgcttcgatttgtagcggtggcggtcaaggggat
gcagtgatgattgaagttcactaa

DBGET integrated database retrieval system