KEGG   Buchnera aphidicola BCc: BCc_059Help
Entry
BCc_059           CDS       T00423                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcc  Buchnera aphidicola BCc
Pathway
bcc00300  Lysine biosynthesis
bcc01100  Metabolic pathways
bcc01120  Microbial metabolism in diverse environments
bcc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCc_059 (dapE)
Enzymes [BR:bcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BCc_059 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABJ90537
UniProt: Q058B2
Position
65594..66724
Genome map
AA seq 376 aa AA seqDB search
MHTNVLNLSKKLINISSISPRDLGCQEILIKRLQLLGFFIERINLKDTKNFWAYRGKGKT
VTFLGHTDVVPAGSTRKWKTSPFVATIKDGKLFGRGSADMKGSIAAMLIAVENFIKKFPN
HKGRISFLITSDEETSGKNGIRKVVSILKEKKEVIDFCLVGEPTSEKILGDCVKNGRRGS
LSADLMIYGTQGHIAYPKLFLNPIHNSIPFLLDLSNLIFDKGNLFFEPTSIQISKIFSEK
NCTLNMIPGELRVFFNIRFNTLVNKKKIIRIVENLLNKYLIKYSIFWTYHAKPFLSSSNF
LLNLLTKCIYKHTNIIPKIKNNGGTSDARFIFNLTDKIIEFGLPNLTIHKVNEYVYINDL
LKLQNIYYSFLEKLLL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcatactaatgttttaaatctttcaaaaaaattaattaatatatcttcaattagtcct
cgagatttaggttgtcaagagattttaattaaacgtcttcaattattgggattttttata
gaacgaataaatttaaaagatacaaaaaatttttgggcttatagaggaaagggaaagaca
gtgacttttttaggtcatactgatgttgttccagctggaagtactagaaagtggaaaact
tcaccatttgtagcaactataaaagatggtaagttatttggtagaggttcagctgatatg
aagggttctattgcagctatgttaattgcagtagaaaattttattaaaaaatttccgaat
cataaaggtcgaatatcatttttaataacttctgatgaagaaacttcaggaaaaaacgga
attagaaaagtcgtttcaatattaaaagaaaaaaaagaagtaattgatttttgtttagta
ggagaacctactagtgaaaaaattttaggagattgtgttaaaaatggtcgacgaggatct
ctttcagcagatttaatgatttatggtactcaaggacatatagcctatccaaaattattt
ttaaatcctattcataattctattccatttttattagatttgtctaatttaatttttgat
aaaggtaatttattttttgaacctacaagtattcaaatttctaaaatattttctgaaaaa
aattgtacattaaatatgattccaggagaattaagagttttttttaatattcgttttaat
actttagtaaataaaaaaaaaataataagaattgtagaaaatttattaaataaatattta
ataaaatattctattttttggacatatcatgcaaaaccatttttatcatcatcgaatttt
cttttaaatttattaactaaatgtatatataaacatacaaatattattccaaaaattaaa
aataatggtggtacttctgatgcacgatttatttttaatttaactgataaaataatagaa
tttggtttaccgaatttaactattcataaagttaatgaatatgtgtatattaatgattta
ttaaaattacaaaatatttattatagttttttagaaaagttattattatga

DBGET integrated database retrieval system