KEGG   Bartonella clarridgeiae: BARCL_0069
Entry
BARCL_0069        CDS       T01394                                 

Definition
(GenBank) Bartonella effector protein (Bep); substrate of VirB T4SS
Organism
bcd  Bartonella clarridgeiae
SSDB
Motif
Pfam: Fic ID Bep_C_terminal
Other DBs
NCBI-ProteinID: CBI75750
UniProt: E6YFW2
Structure
PDB: 
4NPS

Position
complement(79220..80896)
AA seq 558 aa
MEKTLSNAAIATESISNQALPSHYNYPNSLTLKNKYGITNHKDFTNKCAHDSAKAAINLR
QEEPPKKFDSSYLKYLHKQLFKETFEWAGHTRDLPFTFADGTVGVMPEMIRSNWRTEQPI
IFATGNKVQDGLKNIDKMLIEKNNLQGLSHKEFIENIAEIFACLNYTHPFREGNGRTQRI
FCEKLAQAAGYYLDFSVVTKERMSEASITAAQDSNLEPMKKLFDDISNPIKTAVLKECIN
SLKNIDHKNINDCIIVAADKGLTYKGIYTDNSPDSIILKTDNIYIICSKNDLAPEQLKTL
KLGDECTITVPMKQNIENTLIPKEKLPPLTKNAIIENIKKDTLIQAKLRQVTHLSKLVYG
SSKILNNQLELINTNQKSGEQLSAQITSSPQSISKLAGIKIFGMKNSMRKKAEDNIIKLA
NSIKSYGSAVKNVETTMIQQHKSEQKRLSKTVKLPSTKLQNILNLPEEKQKEVLLEEKSL
ASSIGKELTDFISSLNARLSPSERKMILESNHQQFAKNVGISESQAETIIKTAQKAKEVY
QKMQKPAVDLTKHLIVSG
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggaaaaaacactctcaaatgcagcaatagcaacagaatcaatatccaaccaagcttta
cctagtcattataactatcctaatagtctcacactgaaaaataaatatggaataacaaac
cataaagactttactaataaatgtgcgcatgattcagcgaaagcagctattaatttgcgt
caagaagaaccgcctaaaaaatttgattcttcctatttaaaatatcttcacaaacaatta
tttaaggaaacgtttgaatgggctggacatacccgtgatcttccatttacatttgcagat
ggtacagttggcgttatgccagaaatgataagatcaaattggagaacagaacaaccaatt
atttttgcaaccggcaataaagtgcaagatggtttaaaaaatatagataagatgcttatc
gaaaagaataatttacaaggcttatcgcacaaagaatttattgagaatatagcagaaata
tttgcttgccttaactatacgcatccttttagagaaggcaatggacgtacacaacggata
ttttgcgaaaagcttgctcaagctgcaggttattatcttgacttttcagttgtgacaaaa
gaacgtatgtctgaagctagcattacagcagcgcaagatagcaatctagaacctatgaaa
aagctttttgatgatatctccaaccccataaaaacggctgttttgaaggaatgtataaat
agcttaaaaaatattgatcacaagaatattaatgattgtattattgtagcagcagataaa
ggtttaacctataagggaatctatacagataatagtccagatagtattatactcaaaacg
gataatatctacatcatctgtagcaaaaatgatctcgcaccagaacaactaaaaacatta
aagcttggtgatgaatgcaccattacagttccaatgaaacaaaatattgaaaacactctc
attccaaaagaaaaactaccccctttaacaaagaatgcaataattgaaaatattaaaaaa
gatactcttatccaagcaaaactacgacaagttacacatttatcaaaacttgtttacggc
agctcaaaaatattaaataaccagctagagttgattaatacaaatcaaaagtcaggcgaa
cagctttccgcacaaatcacgtcttctcctcaatctatttctaagcttgcaggtataaaa
atattcggtatgaaaaactcgatgcgtaaaaaagctgaagataatattataaagctcgct
aactcaattaaaagttatgggtctgctgtaaaaaatgttgaaacaacaatgattcaacag
cacaaatcagaacaaaaacgcctttcaaaaacagtaaaactacccagcacaaaactgcaa
aacattcttaacttaccagaagaaaagcagaaagaagttttattagaggaaaaatcgctt
gcttcttcgattggcaaagagctcactgattttataagttcactcaatgctcgtctctca
ccaagcgagcgtaaaatgatcctggaaagtaatcatcaacaatttgctaaaaatgttggc
atatcagaaagccaagcagaaacaatcatcaaaactgctcaaaaagctaaagaagtatac
caaaaaatgcaaaaaccagcagttgatcttacaaaacatcttattgtatcaggctaa

DBGET integrated database retrieval system