KEGG   Bartonella clarridgeiae: BARCL_0619Help
Entry
BARCL_0619        CDS       T01394                                 

Gene name
virB2
Definition
(GenBank) Type IV secretion system protein VirB2 precursor
  KO
K03197  type IV secretion system protein VirB2
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BARCL_0619 (virB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcd02044]
    BARCL_0619 (virB2)
Secretion system [BR:bcd02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BARCL_0619 (virB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: CBI76300
UniProt: E6YFX3
Position
679426..679776
Genome map
AA seq 116 aa AA seqDB search
MTNNISNNISKNIYISKNIYFIIITLFLTMLVMLNPAYAESSGAASGLGNIDSVLQAIVT
MITGTTAKLIATICVAIVGIGWMYGVIDLRKAAYCVLGIGIVFGASALVTLLKGTP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaacatatctaacaatatatctaagaatatctatatatctaagaatatctat
tttattatcattacactgtttttaacaatgcttgtcatgttaaaccctgcttatgctgag
agtagcggtgctgctagtggtttggggaatattgattctgttttgcaggctattgttact
atgataacaggtacaacagcgaagctcattgcaactatatgtgttgctattgtgggtatt
ggctggatgtatggtgttattgatttacgtaaagcagcatactgtgttcttggtattggc
attgtttttggtgcttctgcccttgttactttattaaaggggacaccataa

DBGET integrated database retrieval system