KEGG   Bartonella clarridgeiae: BARCL_0622
Entry
BARCL_0622        CDS       T01394                                 
Symbol
virB5
Name
(GenBank) Type IV secretion system protein VirB5 precursor; 17-kDa antigen precursor
Organism
bcd  Bartonella clarridgeiae
SSDB
Motif
Pfam: DUF3576
Other DBs
NCBI-ProteinID: CBI76303
UniProt: E6YFX0
Position
682410..682880
AA seq 156 aa
MAAYISSKETNAMKKIMTMLFSSLCFISHAVSQDVEQYYQEAINPPSNTSPSKIAETIYA
SAITNEQKIKEINDKILTADKEAKKSLQIELAILQSKLQVDALKLQAFSIIKSENNKSKE
AEREEEQQKQHASIQKTLQEQLEQAKSKVNIEPRSR
NT seq 471 nt   +upstreamnt  +downstreamnt
atggctgcctatatttcatcaaaggagacgaacgcaatgaaaaaaattatgactatgctc
ttctcatctttatgtttcatctctcacgcagtatcacaagatgtagagcaatattatcaa
gaggccataaatccaccatcaaatacatcaccatcaaaaatagctgaaactatttatgct
tcagccattacaaacgaacaaaaaattaaagaaatcaatgataaaatcttaacagctgat
aaagaggcaaagaagtcgcttcagatcgagctggctattcttcaatctaaacttcaagta
gatgctctaaaacttcaggctttttctattattaaatcggaaaataataaatcaaaagaa
gcagagcgtgaagaagaacaacaaaaacaacatgcatctattcaaaaaacattacaagaa
cagttggagcaagctaaaagtaaggtcaacattgaaccaagatcaagataa

DBGET integrated database retrieval system