KEGG   Bartonella clarridgeiae: BARCL_0625Help
Entry
BARCL_0625        CDS       T01394                                 

Gene name
virB8
Definition
(GenBank) Type IV secretion system protein VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BARCL_0625 (virB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcd02044]
    BARCL_0625 (virB8)
Secretion system [BR:bcd02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BARCL_0625 (virB8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: CBI76306
UniProt: E6YFW7
Position
684369..685052
Genome map
AA seq 227 aa AA seqDB search
MRRSQMKSDEFNEYIREARSFDIDRMRNMRLQMKIFMALTVLFGLMAIALALAVVALTPL
KTVEPFVIRVDNSTGIVDVVSVLKDEPQNYDEAITRYFVSKYIRARESFQLSETANNFRI
ISLLSSLEEQNRFAKWYSGNNPESPQNIYQNMTVAITIKSISFLSKDLIQVRYYKTIRDP
NGKEDISHWVSVMNFSYVNARLSVEDRLINPLGFQVSAYRSDPEVVQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcggagatcacagatgaaaagtgatgaatttaacgaatatataagagaagcgcggtca
ttcgatatcgatcgtatgcgtaatatgcgactgcaaatgaaaattttcatggctttgacc
gtgctttttgggttgatggcaatcgctttagctttagctgtagtggcattaacaccctta
aaaaccgtagaacctttcgttatccgcgtggataattctaccggtatcgtcgatgtcgtc
agtgttctaaaagatgaaccccaaaattatgatgaagcaataacacgctatttcgttagc
aaatatattcgtgcacgcgaaagtttccaattatcagaaacagcaaataactttcgtatc
atttctcttttatcctcactagaagaacaaaatcgttttgccaaatggtattcgggaaat
aatccagaaagcccgcaaaatatctatcaaaatatgactgtagcaatcacaataaaatcc
atctcttttttaagtaaagatctcattcaagtgcggtactataaaacgattagagatccc
aatggaaaagaagatatttcccattgggtttcagttatgaatttttcctacgttaatgca
cgcctttcagtagaagatcgtttaattaacccgcttggcttccaagtatcggcatataga
tctgatccagaggtggtccaatga

DBGET integrated database retrieval system