KEGG   Bartonella clarridgeiae: BARCL_0629Help
Entry
BARCL_0629        CDS       T01394                                 

Definition
(GenBank) Bartonella effector protein (Bep); substrate of VirB T4SS
Organism
bcd  Bartonella clarridgeiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fic ID Bep_C_terminal
Motif
Other DBs
NCBI-ProteinID: CBI76310
UniProt: E6YHH2
Position
687413..689536
Genome map
AA seq 707 aa AA seqDB search
MKKTKKGTIMPNSKLAGYPTLTKEELQKRQKILQSVISAYTIRNTPLHSNTLITLQGYAK
GRYSLSEFNVIMDTNLKAILNEVTDGNINSVSPDTINAHHAIRAIINLHQNFPGIRNIET
ANYCTLIIDELQKRRTIIDSAINTHVIENISLHPSTLIALEEYTKGNYSVNEFDIVMDSI
ETTILDNLKNVNIDSATLNTINAHHRMKAIIALNEESLPEKFDSSYLKYLHGRLFREQFE
PTGHISDHPLTSKDGITASMLTVKILNSNNVFTEDKKIQESLQKFDQMLVAKNNLKGLSR
KEFIDEAAKLFSSLSRIHPFKEGNEITQRMFFEKLAEAAGHQLDFSVVTKERMVRAYSDT
IEKKDNVRSEVIEHLFEDISNPEKVSILKELIYNEFNIKCKDLNNTNIIMPRDDIPYLGI
YKGSIGNAIMVDTENSCVVCLKDYLTPKKLKGLKIGDRLIFKTLNKKNLDTILIPEEQLP
PLTEDEIVQELVKNTIVQEKLEKIERYSKTVYKDSKILHEHIIMMNKNPENYRFFSDQIV
SDPKSISDAANKKFRSNTDQKDIYKLGNAIDDYIMTVKHRKSLMVEQHNAQQKRLGTIVT
MPSKAMQDVLNLPKNMQKETLKSSPLLYKELNNFISDVTFRLLPEEHKALCNADYKTLSE
SIGISESKAKTIIKLVTQSKELCESLKPVRPEQPTEMNINKTNSIRM
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgaaaaaaggaacaattatgccaaattcaaaattagctggttatccaact
ctaacaaaagaagaattacaaaagcgccaaaaaatccttcagtcggtcattagtgcctat
actattagaaatactcctttgcactctaatacactcatcactttacaagggtacgcaaag
ggacgttattcattaagtgaatttaatgttatcatggacactaatttaaaagctattctg
aatgaggtaacagatggaaacataaacagtgtgtctcctgatactataaatgcacatcat
gcaataagagcaattattaatctacaccaaaattttccaggtattcgaaatatagagaca
gctaattattgtactctaataatagatgaattacaaaaacgtcgcacaattattgattca
gccattaatacccatgttattgaaaatatttctttgcatcctagtacactcatagcttta
gaagaatatacaaagggaaactattcagtaaatgaatttgatattgttatggatagtatt
gaaacaacgattctggataatttaaagaatgtgaatatagatagtgcgactcttaatact
ataaatgcgcatcatagaatgaaagcaatcattgccttaaacgaagagtctttgccagaa
aagtttgattcttcttatttaaaatatcttcatggacgtttatttagggaacagtttgaa
ccgactggacatattagcgatcatccactgacatctaaagatggtataactgcaagcatg
ctaacagtgaaaatactgaactcaaataatgtgtttacagaagataaaaaaatccaagaa
agcttacagaaatttgatcaaatgcttgttgcaaagaataatttaaaaggcttatcgcgc
aaagaatttattgatgaggcagcaaaacttttttcttctctcagccgtatacatccattt
aaagaaggcaacgaaattacacaacgaatgttttttgaaaagcttgcagaagctgcaggt
catcaacttgatttttcagttgtgacaaaagaacgcatggtacgtgcctacagtgatacg
atagagaaaaaagataatgtaaggagtgaagttatagaacatctttttgaggatatttcc
aatccagaaaaagtaagtattttaaaggaacttatctataacgaatttaatattaagtgc
aaagatctaaataatacaaatattataatgccacgtgatgatataccctatttaggtatt
tataaaggaagtattggaaatgctattatggttgatacagagaattcttgtgtcgtatgc
cttaaagattatctcacaccgaaaaaactcaaaggattaaagattggtgataggctcatt
tttaaaactttaaacaaaaaaaatttagatacaattctcatcccagaagaacaattacct
cctttgacggaagatgaaattgttcaagagcttgtaaaaaataccattgtccaagaaaaa
ttagaaaagatcgagcgatattcaaaaactgtgtataaagattcaaaaatactgcatgaa
catataataatgatgaataaaaatccagaaaattatagatttttttccgatcagattgtt
tctgatccaaaaagtatttctgatgcagcaaataaaaaattcagatctaacacagatcaa
aaggacatttataaacttggtaacgcaattgatgattatattatgactgtaaaacatcgt
aaaagtctaatggttgaacagcataatgcacaacaaaaacgccttggaacaatagtaaca
atgcctagcaaagcaatgcaagatgttcttaacttgccaaaaaatatgcagaaagaaact
ttaaagtcctctcctctcctttacaaagaactcaataattttataagtgatgttaccttt
cgtcttttaccagaagagcataaagcgctctgtaatgctgattataaaacactctctgaa
agcattggtatatcagaaagtaaagcgaagacaattataaaacttgttacccaatccaaa
gagttgtgtgaatcattgaaaccagtcagacctgagcagccaacagaaatgaatataaac
aaaacaaattctataagaatgtag

DBGET integrated database retrieval system