KEGG   Bartonella clarridgeiae: BARCL_0631Help
Entry
BARCL_0631        CDS       T01394                                 

Definition
(GenBank) Bartonella effector protein (Bep); substrate of VirB T4SS
Organism
bcd  Bartonella clarridgeiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bep_C_terminal ID Fic
Motif
Other DBs
NCBI-ProteinID: CBI76312
UniProt: E6YHH4
Position
691657..693285
Genome map
AA seq 542 aa AA seqDB search
MTTSSDISLARNYAYPNSKTLKNKYGIMDFKKLEKKCTHDAKKVIVNLHQEPLPEKFDSS
YLKYLHKCLFEDAFEWAGHTRDLPFTFKDGTTAQMLMMKMPNSNIFFVASNKIQESLQEF
DQMLVAKNNLQGLSREEFIDEAAKLFSSLNYIHPFRGGNEPTQQMFFEKLAEAAGHRIDF
SIVTQERMIRACTDAITLKGDEAHEAMKHLFEDISNPEKVRVLKELLNHIPRLECKRLDN
EYVVMPREGMTYTGIYKGGSLDSIIVETVDSCVICHKDYLTPEQIKALKPGNRVTFTVPI
NKDLDQILIPAEKLAPLREEEIIKKIKNTDCIKESRKGIDHLLKLVYGDPTILDKHMNLI
NKDPEMGQQLAEQIRNSPKSISKLAGFKIWRIRSPKRRVAERNISSLSRAITQHVQIVKS
VKDKIFIEYKRKQKRLEQVVKIPSKEVRESLNLPKDIQKKALESSPSLHRDLCDFLCKVN
SRLSMSELEHIRDTNHKILAESIGISQSKAKIITQTFNKGVKLYKQFETIKADRSKIAAM
TI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcttccgatatatccttagcccgtaattatgcctatcctaacagtaaaaca
ttaaagaataaatatggaataatggattttaaaaaacttgaaaagaaatgtacacatgat
gcaaaaaaagtaatcgtcaatttgcatcaagaaccgctaccagaaaagtttgattcttct
tatttaaaatatctccataaatgcttatttgaagacgcatttgaatgggccggacatacc
cgcgatctcccctttacatttaaagacggcacaactgcccaaatgttaatgatgaaaatg
ccgaattcaaatattttttttgtagctagtaacaaaattcaagaaagcttacaggaattt
gaccaaatgcttgttgcaaagaataatttgcaaggtttatcgcgcgaagaatttattgat
gaggcagcaaaacttttttcttctctcaactatatacatcctttcagaggtggtaatgaa
cctacacaacaaatgttttttgaaaagcttgcggaagctgcaggtcatagaattgatttt
tcaattgtgacacaagaacgcatgatacgtgcttgtactgatgcgataactctaaaaggt
gatgaagctcatgaagcgatgaaacatttatttgaagatatttccaatccagaaaaagta
cgtgttttaaaggaattactcaatcacatacctaggcttgagtgcaaacgtttggataat
gaatatgttgtaatgccacgtgaaggtatgacctatacaggtatttacaaaggaggtagt
ttagattctattatagttgaaacagtggattcttgcgtcatatgtcataaagattatctt
acaccagaacaaatcaaggcattaaaacccggtaatcgggttacctttacagttccaata
aataaagatttagatcaaattcttatcccagcagaaaagttagctcctttgagggaagag
gaaataatcaaaaagattaaaaatactgattgtattaaagaaagccgaaaaggaattgac
catttattaaagcttgtttatggagatccaacaatattagataagcatatgaatcttatt
aataaagatcctgaaatgggtcaacagcttgccgaacagattagaaattctcctaaatct
atttctaaactcgcaggcttcaaaatatggcgtataaggagtccaaaacgcagggtagct
gaaagaaatatttcaagcctcagtcgagcaattacacaacatgtgcaaattgtaaaatct
gttaaagataaaatttttatagagtataaaagaaaacaaaaacgacttgagcaagtagta
aaaatacctagtaaagaagtgcgagagagtcttaatttgccaaaggatatacaaaaaaaa
gctttagagtcttctccttcacttcacagagatctttgtgattttctgtgtaaagtcaat
tctcgtctttcaatgagtgagctagaacatattcgtgatactaatcataaaatactggct
gaaagtattggcatatcacaaagtaaagcgaagataattacacaaacttttaataaagga
gtaaaattatacaaacaatttgaaacaatcaaagctgaccgttcgaaaatagcggctatg
accatctga

DBGET integrated database retrieval system