KEGG   Bartonella clarridgeiae: BARCL_0632Help
Entry
BARCL_0632        CDS       T01394                                 

Definition
(GenBank) Bartonella effector protein (Bep); substrate of VirB T4SS
Organism
bcd  Bartonella clarridgeiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bep_C_terminal ID Fic
Motif
Other DBs
NCBI-ProteinID: CBI76313
UniProt: E6YHH5
Position
693480..695072
Genome map
AA seq 530 aa AA seqDB search
MYSFYYYPDTQILKNKYGIMNEKELNAQCSRDTAKAIVSLRQEPLPEKFDSSYLKYLHKC
LFANTFEWAGHTRNLPFKFEDGTRGKLLVMRIPNSNNFFVSGSNIKKSLQEFDKTLSEKN
NLQGLSRKEFIEEAVKLFSFLNYIHPFRTSNGRAQRMFFEKLAEAAGHRLDFSVVTKQRM
IRVCNDAIPVKGNINYEGMKHLFEDISNPEKVYLLKKFVCQVPKAERKNLNNKVVIISRE
GMTYEGLYIKSGLDSVMIETKDFCVICHKDYLTPEQLKTLKPGNQLTVTVPINDLNKILI
PAEKLAPLTEDDIIKKIENDAGVQASRKKIEELSKLVYGNSKILNSSITLIHTNFDFGSD
LSKQIINSPKSISKLLGYKILGIRSPARKNAESNISALSTEVNKYVDMVLEIKYEIIGKH
KAKEKRLAQTVKMPSKEMQDMLNLSRRMQIKTLESSPALYTELTHFMRKITLRLSTRENQ
GLRNANYKELSESIGISENKAKIIIETVDKTKRLLELLQPNRPQMITKTI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtattcattctattattatcctgatactcaaatattaaaaaataaatatggaataatg
aatgaaaaagaattaaatgcccaatgcagtcgtgatacagcaaaagcaattgtcagtttg
cgtcaagaaccactaccagaaaagtttgattcttcttatttaaaatatctccataaatgc
ttatttgcgaacacgtttgaatgggccggacatacccgcaatctcccctttaagtttgaa
gatggcacgcgtggcaaattgttggtgatgcgaataccaaactcaaataatttttttgtc
agtggtagcaatatcaaaaaaagcttgcaggaatttgataagacgctttctgaaaagaat
aatttacaaggattatcgcgtaaagaatttatcgaggaggcggtaaagcttttttccttt
cttaactatatacatccattcagaactagtaatggacgtgcgcaacgaatgttttttgaa
aagcttgcagaagccgcaggtcataggcttgatttttcagttgtgacaaaacaacgcatg
atacgtgtttgtaatgatgcgatacctgtaaaaggtaatataaattatgaagggatgaaa
catctctttgaagatatttccaatccagagaaagtatatcttttaaaaaaatttgtttgc
caggtacctaaggctgaacgtaaaaatctaaataataaagttgttataatttcacgtgaa
ggtatgacctatgagggtctctatataaagagtggtttagattctgttatgattgaaaca
aaggatttttgcgtcatatgccataaagattatcttacaccagaacaactgaagacatta
aaacccggtaatcagcttactgttacagttccaataaatgatttaaacaaaatactcatc
ccagcagaaaaattagctcccttgacagaagacgacataatcaaaaaaattgaaaatgat
gctggtgttcaagcaagtcgaaaaaaaatcgaagagctatcaaaacttgtttacggcaat
tcaaaaatattaaattcaagtataacgcttattcatacaaatttcgatttcggtagtgat
ctttctaaacagattataaattctcctaaatctatttctaagttattaggttacaaaata
ttaggcataagaagtccagcacgtaaaaacgctgaaagcaatattagtgcacttagtact
gaagttaataagtatgtagatatggtattagagattaaatatgagattattggaaaacat
aaagcaaaagaaaagcgccttgcacaaacagtaaagatgcctagtaaagaaatgcaagat
atgcttaacttatctagaagaatgcaaataaagactttagagagctctcctgcactttac
acagaactcactcattttatgcgcaaaatcactctgcgtctttcaacaagagagaatcaa
gggcttcgtaatgctaattataaagaactttctgaaagtattggtatatcagaaaataaa
gcaaagataataatagaaaccgttgataaaactaaaaggttattggagctattgcaacct
aaccgcccacaaatgataactaagaccatctga

DBGET integrated database retrieval system