KEGG   Bartonella clarridgeiae: BARCL_0641Help
Entry
BARCL_0641        CDS       T01394                                 

Gene name
virB11
Definition
(GenBank) Type IV secretion system protein VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BARCL_0641 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcd02044]
    BARCL_0641 (virB11)
Enzymes [BR:bcd01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BARCL_0641 (virB11)
Secretion system [BR:bcd02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BARCL_0641 (virB11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE ABC_tran AAA_23 AAA_7 AAA_29 Zeta_toxin FtsK_SpoIIIE AAA_22 ResIII Sigma54_activat AAA_18 TsaE DUF87 DEAD DUF815 ATPase AAA_16 TrwB_AAD_bind PduV-EutP Sigma54_activ_2 RNA_helicase ArsA_ATPase IstB_IS21 CbiA Mg_chelatase AAA_24 NACHT cobW AAA_33 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBI76322
UniProt: E6YHI4
Position
complement(704616..705686)
Genome map
AA seq 356 aa AA seqDB search
MKQNSQNISDETVAIVSTKLKPIRTFLKDESLFEIVINRPYQVMIEGIKGWKTIEVPELS
FNELIGIAKVIAAYSKQNISDKNPILSATLPDNERIQIVIPPAVEKDTISITIRKPSSRN
YSLEDLADKGLFSMCEQVSFTSLNDYQSRFNELKSIERELVIDYYNKNFVSFLNQAVKLQ
KNILISGKTGSGKTTLSKALIAKIPNDERIITIEDTPELIVPHPNRVSMIYAKDGHGLAS
VGPKQLLESALRMRPDRILLQELRDGTAFYYIRNVNSGHPGSITTVHASTALAAFEQMTL
LVKESEGGADLERDDIRGLLISMVDVIIQCKRIEGKFKVTEIYYDPFKQRNIFGGN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaactctcaaaatataagtgatgaaaccgtcgctatcgtctcaacaaaactc
aaaccaattcgtacctttctcaaagatgaaagtctcttcgaaatcgtcattaatcgtccc
tatcaagtcatgatcgaaggaataaaaggatggaaaacaatcgaagttccagaactctcc
tttaatgaactcatcggtatcgctaaagtcattgccgcttattctaagcaaaatatttcc
gataaaaatccaatattatcagctaccttgccggataacgagcgtattcaaattgtcatt
ccaccagctgtagaaaaagacacaatcagcataacaattcgtaaaccatcgtcgcgaaat
tattcactcgaagatctggctgataaaggtcttttttcaatgtgtgaacaggtctctttc
acctcattgaatgattatcaatcgcgttttaatgaacttaaaagtatcgaacgtgaattg
gtaatcgattattacaataaaaactttgtttcttttttaaatcaggctgtgaaattgcaa
aaaaatatccttatttcaggaaaaacagggtctggtaaaacaacgctttcgaaagcgttg
atcgctaaaattcctaatgacgagcgtattataactattgaagatacaccagaattgatc
gtgccacatcctaatcgtgtctctatgatctacgcaaaagatgggcatggtttagcttct
gttggaccaaaacagttacttgaatctgctttacgaatgcgtcctgaccgtattcttcta
caagagttgcgagatggtactgctttttattatatccgtaatgttaattcaggacaccca
ggttcgattacaacagttcatgcgtcaacagcacttgctgcatttgagcaaatgactctg
ctggtcaaagaaagtgaaggaggagccgatttagagcgcgatgatattcgaggattatta
atttcaatggttgatgttatcattcaatgcaaacggatcgaaggaaaatttaaggttaca
gaaatttattatgatcctttcaagcaacgaaatatctttggaggtaattaa

DBGET integrated database retrieval system