KEGG   Bartonella clarridgeiae: BARCL_0684Help
Entry
BARCL_0684        CDS       T01394                                 

Definition
(GenBank) exopolyphosphatase, Ppx/GppA family
  KO
K01524  exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd00230  Purine metabolism
bcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BARCL_0684
Enzymes [BR:bcd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     BARCL_0684
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     BARCL_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ppx-GppA
Motif
Other DBs
NCBI-ProteinID: CBI76365
UniProt: E6YHM7
Position
757718..759232
Genome map
AA seq 504 aa AA seqDB search
MTYINAQGRLKGHKPVAVIDIGSNSVRLVVYEGLVRSPTVLFNEKVLCGLGQGVAKTGIL
EEKAIEMALRALKRFRAICQQVGADEIYTLATAAAREAKNGSVFIQNAENILQNQIYVVS
GNEEAVYSAYGVISTFYRPNGISGDLGGGSLELIDIHDFNVGKGITLPLGSLRLQYISNN
DLVLAKKIVHEQLCKSSIVTHKDIAHCFYAVGGTWRNLAKLYMVIKNYRLPVMHSYEVDV
QEMEEFLLLVINGSIDKIKEISAISKNRHQLLAYGAVVLIELIKCIGFKKIIFSGAGVRE
GFLYSKLLEEDRISDPLIAACLEMATLRARSPKQASELIDFTTNAFEAFGISETENACRY
RKAACLLSDIGWRIHPDYRGNEAANQIALGSYPGISHKGRIYAALAIFFCNTGLSLDKKA
PEILKLATSDIVEKARVLGGIMRIANLFSPSTAGILPNLSWQKKRDNIALRIPVRYADLI
GERPLERLQQLSKITKLSLAFEVF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacatatataaatgctcaaggtcgattgaaggggcataaacccgtagcagttattgac
attggttcaaattctgttcgacttgttgtttatgaaggccttgtacgttcaccgacagtt
ttatttaatgaaaaagttctttgtggtcttggtcaaggtgttgcaaagactgggatttta
gaagaaaaagcaattgaaatggccttgcgagcactgaaacgatttcgtgctatttgtcag
caggttggtgcagatgaaatctatactttagcaacagcggcagcacgagaagcgaaaaac
gggtcagtttttattcaaaacgctgaaaacattttacaaaatcaaatatatgttgtttca
ggaaatgaagaggctgtttattcagcttatggagttatttctaccttttatcgaccaaat
ggcatttctggtgatcttggtggtggaagtcttgaacttattgatattcatgattttaac
gtaggtaaagggataacactgccattagggagtttgcgactgcaatatatatcaaataat
gatcttgttttggcaaaaaaaattgttcatgagcaactttgtaaatcttctattgttacc
cataaagatatagctcattgtttttatgctgtaggaggaacttggcgtaatcttgcaaaa
ttatatatggtaatcaaaaattatcgattgcctgttatgcatagttatgaggttgatgtg
caagaaatggaagaatttttgcttcttgtcatcaacggtagcattgataagataaaagaa
atttcagctatttcaaaaaaccgtcatcagcttttagcgtatggcgcggttgttcttatt
gaactgatcaaatgtataggttttaaaaaaataattttttctggagcaggagttcgcgaa
ggttttctttattcaaaattactagaagaagatcgtatttctgatccattaattgcggca
tgcttagaaatggctaccttaagggcacgctcaccaaagcaagcaagtgagctcattgat
tttactacaaatgcgtttgaggcttttggaatttcagaaactgaaaatgcatgtcgttat
cgtaaagcggcttgtcttctttctgatatcggttggcgtatacatccagattatcgaggt
aatgaagcagccaatcagatagcgttaggatcttatccgggaatttcacataaggggcgt
atttatgctgcattagctatttttttctgtaatacgggcttatcgcttgataagaaagct
cctgagattctcaaattagctactagcgatattgttgaaaaagcgagagttcttggtggc
attatgcgtattgctaatctttttagtccttctactgcaggaattttgcctaatttatct
tggcaaaagaagcgagataatattgcattgcgtattccagtacgctatgctgatttaata
ggcgaacgacctttggagcgtttacagcaattatcaaaaataactaaactttctttagct
tttgaggttttttga

DBGET integrated database retrieval system