KEGG   Bartonella clarridgeiae: BARCL_0762Help
Entry
BARCL_0762        CDS       T01394                                 

Gene name
metS
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd00450  Selenocompound metabolism
bcd00970  Aminoacyl-tRNA biosynthesis
bcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BARCL_0762 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BARCL_0762 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcd01007]
    BARCL_0762 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcd03016]
    BARCL_0762 (metS)
Enzymes [BR:bcd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BARCL_0762 (metS)
Amino acid related enzymes [BR:bcd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BARCL_0762 (metS)
Transfer RNA biogenesis [BR:bcd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BARCL_0762 (metS)
 Prokaryotic type
   Other AARSs
    BARCL_0762 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f DALR_1 tRNA-synt_1c Anticodon_1
Motif
Other DBs
NCBI-ProteinID: CBI76443
UniProt: E6YHV5
Position
846906..848447
Genome map
AA seq 513 aa AA seqDB search
MRDIYYITTPIFYPNGTPHIGHAYNAIVSDALARFQRADGKDVFFLSGTDEHGLKMQQTA
QMLNITPQQLADRNSAVFQKMLEILNCSNNDFIRTTEKRHHQASQELWKKMEAKGDIYLG
RYTGWYSVSQEAYYEEKDTEIDEKGIRREKELNSPVEWNEEESYFFRLSRYEKALLQHYE
KYPDSIGPNERRNEIISFIKSGLKDLSISRTTFDWGVRVPGNPKHVMYVWVDALTNYLTA
IDFFDETSQKRNFWPADIHIIGKDIIRFHTVYWPAFLMSVGIELPKRIFAHGFLLNRGVK
MSKSIGNVVDPFEMVDRYGLDQVRYFFLREVPFGHDGNYDHDSFVNRINADLANDLGNLA
QRSLSMIQKNCNAKIPTPAAFLIQDEQLLKQSLQALEIARQTMSRQAPHLALSAIFSVVA
EANRYFANEEPWRLHKNNPERFFTVLYITLEILRRIGIMLLPFIPQSATKLLDSLVVAKE
NRFLHHISDLKIKEDTELPSPVPIFPRYIPKES
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacatatattatataacaactccaattttttatcctaatggtactccgcatatt
ggacatgcctataacgcaattgtaagcgatgctttagctcgttttcaaagagccgatggg
aaggatgtattttttctatctggtacagatgaacatggcctaaaaatgcaacaaacagca
caaatgttaaacataacacctcaacaacttgcagaccgcaatagtgctgtttttcagaaa
atgctggaaattcttaattgttctaataacgattttatccgcacaacggaaaaacgacat
catcaagcttctcaagagctttggaaaaaaatggaagccaaaggtgatatttaccttggc
cgttatacgggttggtattcagttagtcaagaagcttattatgaagagaaagatactgaa
attgatgaaaaaggaatccgtcgtgagaaagagttaaactctccggttgaatggaatgaa
gaagagagttattttttcagactttcacgttatgaaaaagcacttcttcaacattatgaa
aaataccctgattctattggccctaatgaacgacgtaatgaaattataagttttatcaaa
tcaggcctaaaagacctttccatttcacgaacaacctttgattggggagttcgtgttcca
ggaaatccaaagcatgtaatgtacgtctgggttgatgcacttacaaattatcttactgcg
attgattttttcgatgaaacttcacaaaaacgcaatttttggcctgcagatattcatatt
attggtaaagacattattcgtttccacacagtttattggccagcatttttaatgtctgtt
ggaattgagttacctaaacgtatttttgctcatggttttttacttaaccgcggtgttaaa
atgtcaaagtctattggaaacgtagttgatccttttgaaatggttgatcggtatggtctt
gaccaagtacgttatttttttcttcgtgaagtaccatttggacatgatggtaattacgat
catgatagttttgtaaatcgtatcaacgctgatcttgcaaatgatcttggcaatttagct
caacgctcattatctatgattcaaaaaaattgtaatgcaaaaattcctacaccagctgca
tttctaattcaagatgaacagctgctaaaacaatctcttcaagcacttgagattgcacgc
caaactatgtcacgtcaggctccacatttagcactttcagctattttttcagttgtagca
gaggctaatcgttattttgctaatgaagaaccttggagattgcataaaaataatccagaa
agattttttacagttctttatataactttagagattttgcggcggataggaatcatgctt
ttgcctttcattccacaatcagcaactaaacttcttgatagtcttgtagttgctaaagaa
aatcgatttttgcaccatatcagtgatttaaaaattaaagaagatacagagcttccatca
ccagtaccaattttccctcgttatattcctaaagaaagctga

DBGET integrated database retrieval system