KEGG   Bartonella clarridgeiae: BARCL_1095Help
Entry
BARCL_1095        CDS       T01394                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd00040  Pentose and glucuronate interconversions
bcd00052  Galactose metabolism
bcd00500  Starch and sucrose metabolism
bcd00520  Amino sugar and nucleotide sugar metabolism
bcd01100  Metabolic pathways
bcd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BARCL_1095 (galU)
   00052 Galactose metabolism
    BARCL_1095 (galU)
   00500 Starch and sucrose metabolism
    BARCL_1095 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BARCL_1095 (galU)
Enzymes [BR:bcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BARCL_1095 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CBI76776
UniProt: E6YIT8
Position
complement(1218281..1219171)
Genome map
AA seq 296 aa AA seqDB search
MHKIRKAVFPVAGLGTRFLPATKTVPKEMLTVVDKPVIQYVVDEAREAGIEHFIFVTGRN
KAVIEDYFDAQVELYTTLAECGRIEELEHLKDLQLQPGTTSFTRQQQPLGLGHAVWCARE
LVGNEPFALLLPDMLMQTEKSCLSEMIHLYEKTGGGNIIAVQECNPEEVYKYGIVRKGKQ
VANGFEITQMLEKPAIEIAPSNLYINGRYILQPEIFDILSDQKRGTGNEIQLTDAMVRLS
NEQDFFGFQLDGYTFDCGSKIGFIEANVAFALSRTDMHQQLSVSLKNLLAKINVEK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaaatccgtaaggcagtatttcctgtagcaggtcttggtactcgttttcttccg
gcaacaaaaacagttcctaaagaaatgctaactgttgttgataaacctgttattcaatat
gttgtagatgaggcacgtgaagcaggtattgagcatttcatttttgttactgggcgcaat
aaggcagttattgaagattactttgatgctcaagttgagttatatacaactcttgctgaa
tgtggaagaatagaggaactcgagcatttaaaagatttgcaattacagccaggaacaact
tcttttactcggcaacagcaacctttgggattagggcatgctgtttggtgtgcgcgtgag
ctcgttggaaatgagccttttgccttattattgccggatatgctcatgcaaactgaaaaa
agttgcctttctgagatgatccatctttatgaaaaaacaggagggggtaatattattgct
gttcaagagtgcaatcctgaagaagtatataaatatggtattgtgcgaaaaggaaaacag
gttgcaaatggttttgaaatcacacaaatgttagagaaaccagctatagaaatagctcca
tctaatctatatattaacggacgttatattttgcagccagagatttttgatattttatct
gatcaaaaacgaggaacagggaatgaaattcaattaacagatgctatggtacgactttca
aatgagcaggatttttttggttttcagttagatggatacacttttgactgtggttctaaa
attggttttattgaagctaatgttgcatttgctctctcacgtactgatatgcatcaacaa
ctttctgtatcgttgaaaaacttacttgcaaaaattaacgttgaaaaatga

DBGET integrated database retrieval system