KEGG   Bacillus cereus ATCC 14579: BC0243Help
Entry
BC0243            CDS       T00127                                 

Definition
(RefSeq) oligopeptide transport system permease oppC
  KO
K02034  peptide/nickel transport system permease protein
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce02024  Quorum sensing
Module
bce_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:bce00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BC0243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bce02000]
    BC0243
Transporters [BR:bce02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    BC0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-GeneID: 1202596
NCBI-ProteinID: NP_830111
UniProt: Q81IV3
Position
219029..219949
Genome map
AA seq 306 aa AA seqDB search
METVTVITEKKEKKRRNESSPWRQAFKKIKKNKMALVGFYALIFMFLFCFIGPFFSPYAS
GKIQVALINKPPSFSHWLGTDQLGRDILTRLMQAGRISLTIGLASMVLSVILGALLGAIA
GFYRGIVDNIIMRLADILMSMPGLPLLIIMGAILSEWKVPSDYRLYVIMIILSLVGWPGL
ARLVRGQILSLREQAFMQAADVLGIKDYRKIIYHLIPNVLPILIVVSTLGVAGSILGESA
LSYLGLGVVPPTPSWGNMISAANSLIDFQKRPWLWIPPGFAIFITVVSINLLGDALRDAL
DPKMRR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggagactgttacagtaattacagaaaaaaaagaaaaaaagagaagaaatgaatcatca
ccatggcgacaagcttttaaaaagataaagaaaaataagatggcacttgtagggttttat
gcattaatttttatgtttttattttgttttatcggtccgttcttttctccatatgcatca
ggaaaaatacaagttgcgctcattaacaaaccacctagtttttctcattggcttggtaca
gatcaattaggaagagatattttaacaaggcttatgcaagcgggacgtatttcattaacc
attggtttagcttcaatggttttatcggttatacttggagctttattaggagcgattgca
ggtttttatcgtggtattgtggacaatattattatgcgacttgcagatattttaatgtcg
atgccaggattaccgttacttattataatgggtgcgattttatcagagtggaaagtaccg
tctgattatcgtttgtatgtcattatgattattttaagtttagtaggttggccagggctt
gcacgccttgtaagagggcaaattttatcacttagggagcaagcatttatgcaagctgcg
gatgtgttaggaataaaagattaccggaaaattatatatcacttaatacctaatgtttta
cctattttaattgtcgtatctacattaggtgttgcaggttctattttgggagaatccgca
ctaagttacttaggtcttggagtcgttccacctacaccatcatgggggaacatgattagc
gcagctaactcattaatcgatttccaaaagcgtccatggttatggattccgcctggtttt
gcaatctttataacagttgtatcaattaatttacttggtgatgcacttcgtgatgcatta
gatccaaagatgagacggtag

DBGET integrated database retrieval system