KEGG   Bacillus cereus ATCC 14579: BC0254Help
Entry
BC0254            CDS       T00127                                 

Definition
(RefSeq) homogentisate 1,2-dioxygenase
  KO
K00451  homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00350  Tyrosine metabolism
bce00643  Styrene degradation
bce01100  Metabolic pathways
bce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BC0254
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    BC0254
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     BC0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HgmA Cupin_2
Motif
Other DBs
NCBI-GeneID: 1202607
NCBI-ProteinID: NP_830122
UniProt: Q81IU4
Position
226466..227638
Genome map
AA seq 390 aa AA seqDB search
MFYRHMGELPHKRHVQFRKKDGSLYREQVMGTKGFSGTQSILYHHYMPTEVGHSALSHSC
QLQYEEDVALSHRHFRTKESKKSGDAISGRNFILGNEDLLIGVVSPTEKMDYFYRNGDGD
EMLFVHYGTGKIETMFGTIHYRKGDYVTIPIGTIYRVIPDEGETKFLVVEANSQITTPRR
YRNEYGQLLEHSPFCERDLRGPEKLETYDEKGEFVVMTKSRGYMHKHVLGHHPLDVVGWD
GYLYPWVFNVEDFEPITGRIHQPPPVHQTFEGHNFVICSFVPRLYDYHPESIPAPYYHSN
VNSDEVLYYVEGYFMSCKGVEEGSITLHPSGIPHGPHPGKTEASIGKKETLELAVMIDTF
RPLRIVKQAHVTEDEKYMYSWIEQGSYTVK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgttttatcgtcacatgggagaactacctcataaacgacatgtacaatttcgtaaaaaa
gatggatcgctttatcgtgaacaggtaatgggaacaaaaggtttttctggtacgcagtct
attttgtatcatcattatatgcccacagaagtaggtcattctgcattatcgcattcttgt
cagttgcagtatgaagaggatgttgctctttctcatcgccactttcgaacgaaagaaagt
aaaaaaagtggtgatgcaataagtggacggaatttcatacttggaaatgaagatttatta
attggagtagtgagtccaacagaaaaaatggattatttctatcgtaatggtgatggcgac
gaaatgttatttgttcattatggaacagggaaaattgaaacgatgtttggaacgattcac
tatagaaaaggcgactatgtaacgattccaattggaacgatttatcgtgttattccagat
gaaggagagactaagtttcttgttgtagaggcgaatagccaaattacaacgccgcgtcgt
tatcgaaatgaatacggacaattgttagagcatagtccgttttgtgaaagagatcttcgt
ggtccagaaaaattagagacatatgatgaaaaaggcgagtttgtcgtaatgacaaaatca
agaggctatatgcataaacatgttttaggacaccacccgttagatgttgtgggatgggat
ggctatttatatccgtgggtatttaatgtagaggattttgaaccaattacagggcgcatt
catcagccaccgccagtacatcaaacatttgaaggacataattttgttatttgctctttc
gtaccacgtttatacgattatcatccagagtccattccggcaccatattatcatagtaat
gttaatagtgatgaagttctttactatgtagaaggatactttatgagttgcaaaggtgtg
gaagaaggttctattacacttcatccgagcgggattccccatggaccgcatccggggaaa
acagaggcaagtatagggaagaaagagacgcttgaattagctgttatgatagacacattc
cgtccgcttcgtattgtaaaacaagcacatgtaacagaagatgaaaagtatatgtatagc
tggattgaacaaggttcatatactgtgaaataa

DBGET integrated database retrieval system