KEGG   Bacillus cereus ATCC 14579: BC0258Help
Entry
BC0258            CDS       T00127                                 

Definition
(RefSeq) UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00300  Lysine biosynthesis
bce00550  Peptidoglycan biosynthesis
bce01100  Metabolic pathways
bce01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BC0258
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BC0258
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BC0258
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
    BC0258
Enzymes [BR:bce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     BC0258
Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
 Precursor biosynthesis
  Amino acid ligase
   BC0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 1202611
NCBI-ProteinID: NP_830126
UniProt: Q81IU0
Position
232054..233418
Genome map
AA seq 454 aa AA seqDB search
MLKQVEQMVNGTELAEQYEGITIQGVSIDTRKIEKGNLYVPIQGERFDGHAFVDKAVENG
AVATLWMKDVANPPENLPVIFVEDTLSALQMLAKNYRDQLDVKVVGVTGSNGKTSTKDIV
TSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVLEMGMSSRGEIEFLSKLARPNA
AIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFVYNGDEPLLTNRVPGMNLAAETV
TFGDARANDYYPTTVTLQATGTHFKMNRDENISFYLPVLGKHNVYNTLASMAIAKHFGVT
WEEMKEGLVTLQMTGMRMEIVKTNSGLTIINDAYNASPTAMEAAFHLMNGLDGFAKKIVV
LGDMLELGDQEVQFHYEVGKLIDPAKISHVFTYGRLGAQIAEGAKINFPNERVKAYDNKE
ELVKDLQAVVDVKDVVLIKASRGMKLEEVITMLK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcaagtggaacagatggtaaatggtactgaattagcagagcaatatgaggga
attactattcaaggcgtgtctattgatacgagaaaaattgaaaaaggaaacttgtatgtt
ccgattcaaggggagcgcttcgatggacatgcttttgtagataaagctgttgaaaatgga
gctgtggctacattatggatgaaagatgtagcgaatccacctgagaatcttccggttatt
tttgtagaagacacgctatcggcattgcaaatgttagcgaaaaactatcgcgatcaattg
gatgttaaagttgtaggtgtaacgggtagtaacggtaaaacatctacgaaagatattgta
acaagtcttcttgcgactaaattcaaagtgcaaaaaacagaagggaacttcaataaccat
atcggattacctcttaccattttaaacttagaagaaaatacagaagtagcagtattagag
atgggtatgtcaagccgaggcgaaattgaattcttatctaagttagctcgtcctaatgca
gctatcattacaaatattggtgaggcacatttaatggatttaggatctcgtgaggcaatt
gctgaagcgaaattagaaattgttacaggattacaagaaggtggcgtgttcgtatataac
ggagatgagcctttattaacgaatcgtgttcctggaatgaatttagcagcagaaacggtt
acgtttggtgatgcaagagcaaacgattattatcccacgactgtaacattacaagcaact
gggacacatttcaaaatgaatagagatgaaaatatttcattctacttaccggtgttagga
aaacataatgtgtataatacacttgcttcaatggcaattgcgaaacattttggtgtaacg
tgggaagagatgaaagaaggtttagtaacacttcaaatgacgggcatgcgtatggaaatt
gtgaaaacaaatagtggtttaacaattatcaacgatgcttataatgcaagcccgacggct
atggaagcagcattccatttaatgaatggtttagatggttttgctaaaaaaatcgttgtg
ctcggtgatatgttagaacttggagatcaagaagtacagttccattatgaggtaggaaaa
ttaatcgatccagcaaaaatctcacatgtattcacatacggtagattaggggctcaaatt
gctgaaggagcaaaaattaatttccctaatgaacgtgtaaaggcgtatgataataaagaa
gagttagtaaaagatttacaagcagtagtcgatgtgaaagatgttgtattaataaaagca
tctcgcggtatgaaattagaagaagtaattacgatgttgaaataa

DBGET integrated database retrieval system