KEGG   Bacillus cereus ATCC 14579: BC0258Help
Entry
BC0258            CDS       T00127                                 

Definition
(RefSeq) UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00300  Lysine biosynthesis
bce00550  Peptidoglycan biosynthesis
bce01100  Metabolic pathways
bce01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BC0258
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BC0258
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BC0258
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
    BC0258
Enzymes [BR:bce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     BC0258
Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
 Precursor biosynthesis
  Amino acid ligase
   BC0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 1202611
NCBI-ProteinID: NP_830126
UniProt: Q81IU0
Position
232054..233418
Genome map
AA seq 454 aa AA seqDB search
MLKQVEQMVNGTELAEQYEGITIQGVSIDTRKIEKGNLYVPIQGERFDGHAFVDKAVENG
AVATLWMKDVANPPENLPVIFVEDTLSALQMLAKNYRDQLDVKVVGVTGSNGKTSTKDIV
TSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVLEMGMSSRGEIEFLSKLARPNA
AIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFVYNGDEPLLTNRVPGMNLAAETV
TFGDARANDYYPTTVTLQATGTHFKMNRDENISFYLPVLGKHNVYNTLASMAIAKHFGVT
WEEMKEGLVTLQMTGMRMEIVKTNSGLTIINDAYNASPTAMEAAFHLMNGLDGFAKKIVV
LGDMLELGDQEVQFHYEVGKLIDPAKISHVFTYGRLGAQIAEGAKINFPNERVKAYDNKE
ELVKDLQAVVDVKDVVLIKASRGMKLEEVITMLK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcaagtggaacagatggtaaatggtactgaattagcagagcaatatgaggga
attactattcaaggcgtgtctattgatacgagaaaaattgaaaaaggaaacttgtatgtt
ccgattcaaggggagcgcttcgatggacatgcttttgtagataaagctgttgaaaatgga
gctgtggctacattatggatgaaagatgtagcgaatccacctgagaatcttccggttatt
tttgtagaagacacgctatcggcattgcaaatgttagcgaaaaactatcgcgatcaattg
gatgttaaagttgtaggtgtaacgggtagtaacggtaaaacatctacgaaagatattgta
acaagtcttcttgcgactaaattcaaagtgcaaaaaacagaagggaacttcaataaccat
atcggattacctcttaccattttaaacttagaagaaaatacagaagtagcagtattagag
atgggtatgtcaagccgaggcgaaattgaattcttatctaagttagctcgtcctaatgca
gctatcattacaaatattggtgaggcacatttaatggatttaggatctcgtgaggcaatt
gctgaagcgaaattagaaattgttacaggattacaagaaggtggcgtgttcgtatataac
ggagatgagcctttattaacgaatcgtgttcctggaatgaatttagcagcagaaacggtt
acgtttggtgatgcaagagcaaacgattattatcccacgactgtaacattacaagcaact
gggacacatttcaaaatgaatagagatgaaaatatttcattctacttaccggtgttagga
aaacataatgtgtataatacacttgcttcaatggcaattgcgaaacattttggtgtaacg
tgggaagagatgaaagaaggtttagtaacacttcaaatgacgggcatgcgtatggaaatt
gtgaaaacaaatagtggtttaacaattatcaacgatgcttataatgcaagcccgacggct
atggaagcagcattccatttaatgaatggtttagatggttttgctaaaaaaatcgttgtg
ctcggtgatatgttagaacttggagatcaagaagtacagttccattatgaggtaggaaaa
ttaatcgatccagcaaaaatctcacatgtattcacatacggtagattaggggctcaaatt
gctgaaggagcaaaaattaatttccctaatgaacgtgtaaaggcgtatgataataaagaa
gagttagtaaaagatttacaagcagtagtcgatgtgaaagatgttgtattaataaaagca
tctcgcggtatgaaattagaagaagtaattacgatgttgaaataa

DBGET integrated database retrieval system