KEGG   Bacillus cereus ATCC 14579: BC0259Help
Entry
BC0259            CDS       T00127                                 

Definition
(RefSeq) ATP-dependent RNA helicase
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BC0259
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bce03019]
    BC0259
   03009 Ribosome biogenesis [BR:bce03009]
    BC0259
Enzymes [BR:bce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BC0259
Messenger RNA biogenesis [BR:bce03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BC0259
Ribosome biogenesis [BR:bce03009]
 Prokaryotic Type
  rRNA helicases
   BC0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_30 CMS1 Helicase_RecD
Motif
Other DBs
NCBI-GeneID: 1202612
NCBI-ProteinID: NP_830127
UniProt: Q81IT9
Position
233782..235326
Genome map
AA seq 514 aa AA seqDB search
MGFEEATPIQAETIPHALQGKDIIGQAQTGTGKTAAFGLPLLDKVDTHKESVQGIVIAPT
RELAIQVGEELYKIGKHKRVRILPIYGGQDINRQIRALKKHPHIIVGTPGRILDHINRKT
LRLQNVETVVLDEADEMLNMGFIEDIEAILTDVPETHQTLLFSATMPDPIRRIAERFMTE
PQHIKVKAKEVTMPNIQQFYLEVQEKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEA
LNLRGYAAEGIHGDLTQAKRMSVLRKFKEGSIEVLVATDVAARGLDISGVTHVYNFDIPQ
DPESYVHRIGRTGRAGKKGIAMLFVTPRESGQLKNIERTTKRKMDRMDAPTLDEALEGQQ
RLIAEKLQSTIENENLAYYKRIAEEMLEENDSVTVVAAALKMMTKEPDTTPIALTSEPPV
VSRGGGSKKRGGNGGGYRDGNRNRSRDGRGGGDGRNRDRNRDGRNRDGNRDRNRDGNRDR
NRDGGSRGRRGEGQGRPGSSNGRGERKHHSRPQA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgaagaggctacaccaattcaagctgaaacaattccacatgcattgcaaggt
aaagatattattgggcaagcgcaaacaggtacagggaaaacagcagcattcggattacca
ctattagataaagtggatacacataaagaatcggttcaaggtattgttatcgcgccaacg
cgtgaattagcaattcaagttggagaagaattatacaaaattggtaagcataaacgcgtt
cgtattttaccgatttatggtggtcaagatattaaccgccaaattcgtgctctaaaaaaa
cacccacacattattgttggtacgccgggtcgtattttagatcatattaaccgtaaaaca
cttcgtctgcaaaacgtagagacagttgttcttgacgaagcggatgaaatgttaaacatg
ggcttcattgaagacattgaagcaattttaacagatgtgccagaaacacatcaaacatta
ctattctcagcgacaatgccggatccaatccgccgtattgctgagcgtttcatgactgag
cctcaacacattaaagtaaaagcaaaagaagtaacaatgccaaacattcagcagttctat
ttagaagtgcaagaaaagaaaaagtttgacgtgttaacacgcttattagatattcaatct
ccagagcttgcaatcgtatttggtcgtacaaagcgtcgtgttgatgaattatcagaagca
ttaaacttacgtggttatgctgcagaaggtattcacggtgatttaactcaggcgaaacgt
atgtctgtattacgtaaatttaaagaaggttctattgaagttcttgttgcaacagacgtt
gctgcgcgtggtcttgatatttcaggcgtaacgcacgtatataacttcgatattccacaa
gatccagaatcatacgttcaccgtatcggtcgtactggtcgtgcaggtaaaaaaggtatt
gcaatgctatttgtaacaccacgtgaatcaggacaattaaaaaatatcgagcgtacaaca
aaacgtaaaatggaccgtatggatgcaccgacacttgacgaggcattagaaggtcaacaa
cgtttaatcgctgaaaagcttcaaagcacaattgaaaatgaaaacttagcatactacaag
cgtattgcagaagaaatgttagaagaaaatgactctgtaacagtagtagctgctgcttta
aaaatgatgactaaagagccggatacaactccgatcgctttaacatcagaaccacctgtt
gtttcaagaggcggcggttctaaaaaacgcggcggtaacggaggcggataccgtgatggt
aaccgtaatcgtagtcgtgatggacgcggcggtggcgatggacgtaatcgtgaccgtaac
cgtgatggacgtaatcgtgacggaaaccgtgatcgcaatcgtgatggtaaccgcgatcgt
aatcgtgatggtggtagtcgtggtcgtagaggtgaaggccaaggtcgccctggttcttca
aatggacgcggcgaaagaaaacatcatagccgtccacaagcttaa

DBGET integrated database retrieval system