KEGG   Bacillus cereus ATCC 14579: BC0263Help
Entry
BC0263            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L14e
Motif
Other DBs
NCBI-GeneID: 1202616
NCBI-ProteinID: NP_830131
UniProt: Q81IT6
Position
237493..238509
Genome map
AA seq 338 aa AA seqDB search
MMKRRLFLVLVGLLTVFVLAGCMEKKQDDVVRDLESKVKGMKSYQAEAKLSIKTGNEPQE
YNVEIWHKEPSFYRVNLKNAKKDQSLIILRNEEGVFVLTPALNKSFRFQSDWPQNSSQAY
LYESLVRDILQDKKNLTFEKTDKYYIFKTKTNYQHQNMLPRQEITLNKSDLTPVSVKLMD
NDQNVLVKVDFSKVKFDAKFDKGAFDTKQNMSRAQVDVQTTAKEDKPFAILYPLDTPQGM
TLQDEKELKTDSGKRAILTYTGNKKSFTLIQEKAKVAEASSAVSVSGEPVDLGFTIGALT
KDSVTWSHNGVEYMLVSKGLEPKELLMVARSVTAKQVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaaaaggcgtctgtttttagttcttgtcggtttgttgaccgtttttgtgttggcg
ggttgtatggaaaagaagcaagatgatgtcgtgagagatttagaatcaaaagtaaaaggg
atgaaaagttatcaagctgaggcaaaattatctattaaaacaggcaatgagcctcaagag
tataacgtagagatttggcataaggaaccgtctttttatcgtgtgaatttaaaaaatgca
aaaaaagatcagagcctaattattttgagaaatgaagaaggtgtatttgtattaacgcca
gcacttaataagagcttccgttttcaaagtgattggccgcaaaatagtagccaggcttat
ttatatgaatcacttgtaagagatattttgcaggacaagaaaaaccttacttttgagaaa
acagataagtattatatttttaaaacaaaaacaaactatcaacatcaaaatatgttgccg
agacaagagattacattgaataagagcgacttgactccagtttcagtgaagttaatggat
aatgatcaaaatgttcttgtgaaagtagatttctctaaagtgaaattcgatgcgaaattt
gataaaggtgcatttgatacgaaacaaaatatgtctagagcgcaggtagatgttcaaaca
acagcgaaagaagacaaaccgtttgctattttgtatccacttgatacaccacaaggtatg
actctgcaagatgaaaaagagttgaagacagacagtggcaagcgtgcgatactcacatac
actggaaataagaaatcctttactttaatacaagaaaaggcaaaagttgcagaggcatca
tcagcggtaagtgtaagtggagaaccagttgatcttggatttacgattggtgcattaacg
aaagactctgtaacgtggtcgcataacggagtagaatatatgctcgtgtctaaaggttta
gagccgaaggagctgttaatggttgctcgttcagttacagcgaagcaggtgaagtaa

DBGET integrated database retrieval system