KEGG   Bacillus cereus ATCC 14579: BC0264Help
Entry
BC0264            CDS       T00127                                 

Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00473  D-Alanine metabolism
bce01100  Metabolic pathways
bce01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BC0264
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BC0264
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
    BC0264
Enzymes [BR:bce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BC0264
Peptidoglycan biosynthesis and degradation proteins [BR:bce01011]
 Precursor biosynthesis
  Racemase
   BC0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1202617
NCBI-ProteinID: NP_830132
UniProt: Q81IT5
Position
238627..239796
Genome map
AA seq 389 aa AA seqDB search
MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSNVEIFAVVKANAYGHDYVPVAKTALEAG
ATRLAVAFLDEALVLRRAGITEPILVLGPSPPRDVNVAAENDVALTVFQKEWVDEAIKLW
DGSSVMKFHINFDSGMGRIGIRERKELKEFLKSLEGAPFLELEGVYTHFATADEVETSYF
DKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNAVRIGIAMYGLSPSVEIRP
FLPFELEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEWIATVAIGYADGWLRRLQGF
EVLINGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQGDEYISATEVAEYSGTINYE
IIATISFRVPRIFIRNGKVVEIINYLNNI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcaccattttaccgtgacacttgggtggaagtggatttagatgccatttat
aacaacgttacacatattaaagagttcatcccaagtaatgtagagatttttgctgtagtt
aaagcaaacgcatatgggcacgattatgtaccggtggctaaaacggcattagaagcaggt
gcaacaaggttagctgttgcttttttagatgaagctttagtgcttcggagggctggtatt
actgagccgattttagtgttaggtccctcgccgccgcgtgatgtaaatgtagctgctgaa
aatgatgtagcgctaacggtttttcaaaaagaatgggtggacgaagcaattaaactttgg
gatggttcatctgtaatgaaattccatattaactttgatagtggtatggggagaattgga
atacgtgaaagaaaagagctaaaagaatttttaaagagtttagagggtgcaccgttttta
gagttagaaggagtatacacgcattttgcaacggcagatgaagttgagacttcgtatttt
gataagcaatataacacgttcttagagcagttaagttggttgaaagaattcggagtggat
cctaagtttgttcatacagctaatagtgctgcgacgttacgttttcaagggattacattt
aatgcagtgcgaattgggattgcaatgtatggattatctccttctgtagaaatacgtcct
tttttaccatttgaattagaaccggcgctatcacttcatacgaaagtcgctcatattaaa
caggtaattaaaggtgatggaattagttataacgtcacctaccgaacgaaaactgaagaa
tggattgcgactgtagcgattggctatgcagatgggtggcttaggaggttacaaggattt
gaagtgcttataaatggtaaaagggtaccgattgtagggcgagtaacaatggatcagttc
atgattcatcttccttgtgaagtgccacttggtacgaaagttacgcttattggaaggcaa
ggagatgagtatattagcgctacagaggttgcggaatactcagggactattaattatgaa
attattgcaacgatcagtttccgtgtgccgagaatatttatacggaatggtaaggttgta
gagataattaattacttgaacaatatatag

DBGET integrated database retrieval system