KEGG   Bacillus cereus ATCC 14579: BC0309Help
Entry
BC0309            CDS       T00127                                 

Definition
(RefSeq) methyltransferase
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_4 MTS CMAS Pox_MCEL MetW Methyltransf_8 CheR TehB Methyltransf_PK Methyltransf_29 Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 1202662
NCBI-ProteinID: NP_830154
UniProt: Q81IR6
Position
complement(279116..279988)
Genome map
AA seq 290 aa AA seqDB search
MNKFKLGSDFDHLVNSLSDVELLNLFIQSCSQTTINGVPVPRFPPEEIQKQFVGASYEHA
LYEAYLFYRHIKEYAQNLGVPLNKESKVLDFGCGWGRIIRFLFKDASDQNLLGIDVDPAM
ITLCNETLGRGIYKTASPHPPVEFISDNSLDIIFAYSVFSHLSEATAENWVKEFSRVLRP
GGIFIATTQARYFLDFCQQFQEHPELIQTGWHKTLSQAFPDIHRAISDYENGKFVHSPTG
AGDVRNSSFYGETVIPRTYIENHYEKYLKLQDFFDDVNRLPQALFVLQKI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttaagttaggaagtgattttgatcatcttgttaattcactatctgatgtc
gaacttctaaatttatttatacaaagttgttcacaaacaacgataaatggggttcccgta
cctaggtttcctcctgaagaaattcaaaaacaatttgtaggtgcttcctatgaacatgct
ctttacgaagcatatttgttttatagacatataaaagaatacgcccaaaatttaggggtt
cccttgaataaagaaagtaaagttttagacttcggctgcggatggggaagaattatacgc
ttcttatttaaagatgcctctgatcaaaatttacttggcattgatgtcgatcctgcgatg
atcacactttgtaatgaaacactaggaagagggatatataaaacagcaagtccacatccc
cctgtagaatttattagtgacaattcattagatatcatattcgcttattctgtattctca
catttatccgaagcaactgccgaaaattgggtaaaagaattttcaagagttcttcgccct
ggtggaatcttcatcgcaacaacacaagcgcgctattttcttgatttttgtcaacaattc
caagaacatcctgaattaattcaaacaggatggcataaaactttatctcaagcttttcca
gatatacatcgcgccatctcggattatgaaaacggcaaatttgttcacagtcctactggt
gcaggagatgttagaaatagtagtttttacggagaaactgttatacctaggacttatatt
gaaaatcattatgagaaatatttaaagctacaagacttttttgatgatgtaaatcgatta
ccacaggccctctttgtccttcaaaaaatttaa

DBGET integrated database retrieval system