KEGG   Bacillus cereus ATCC 14579: BC0325Help
Entry
BC0325            CDS       T00127                                 

Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce00250  Alanine, aspartate and glutamate metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Module
bce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
bce_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BC0325
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC0325
Enzymes [BR:bce01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     BC0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ADSL_C DarA_C
Motif
Other DBs
NCBI-GeneID: 1202678
NCBI-ProteinID: NP_830164
UniProt: Q81IQ7
Position
300580..301923
Genome map
AA seq 447 aa AA seqDB search
MGPSRTTVGGKKMISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDVKKI
REHASFDIDRIYEIEKETRHDVVAFTRAVSETPALGEERKWVHYGLTSTDVVDTALSYIL
KQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEMKRNVE
RFKQAADTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHAHYMSTL
ALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTGLARVIRG
YMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYPENMKRNMT
RTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADERITSKLTQE
EINECFNYEHHMQHVDTIFERLGLNEA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
ttgggaccatcaagaacaactgttggagggaaaaagatgattagtcgttatacacgccct
gaaatgggtgcgatttggacggaagagaacaaatttaaagcgtggttagaagttgagatt
ttagcttgtgaagcatgggctgagcttggcgatattccaaaagaagatgttaaaaaaatt
cgtgaacatgcatcatttgatattgatcgtatttatgaaattgaaaaagaaacacgtcat
gacgtagttgcattcactcgtgctgtatcagaaacgccagcattaggcgaagaacgtaaa
tgggttcattacggtttaacatctacagatgtagtagatacagcattatcttacatctta
aaacaagcgaatgaaattatattaaaagacttagagaactttgtaagcattttagctaac
aaagcgaaagagcataaatacacaatcatgatgggaagaacacacggtgttcatgcagaa
ccaacgacatttggtttaaaacttggtctttggtatgaagagatgaaacgtaacgtagag
cgtttcaaacaagctgctgatacagttcgtgttggtaaactatctggtgcggttggtaca
tatgcaaatatcgatccattcgtagaaaaatatgtttgtgaaaatttaggattagaagca
gcaccaatttcaacacaaacattgcaacgtgatcgtcacgcacactacatgtcaacactt
gcactaattgcaacatctatcgaaaagatggcagttgagattcgtggtttacaaaagagt
gaaacacgtgaagttgaagaagctttcgcaaaaggtcaaaagggttcttctgcaatgcca
cataaacgtaatccaattggttctgaaaatatgactggtttagctcgtgttatccgcggt
tatatgatgacagcttacgaaaatgttccattatggcatgagcgtgacatttctcactct
tcggcagaacgcgtaattttaccagatgctacaatcgcattaaattacatgttaaatcgc
tttggtaatattgttaaaaacttaactgtatacccagagaatatgaaacgtaatatgaca
agaacatacggcttaatttattctcagcgcgtaatgcttacactaatcgacaaaggtatg
gtacgtgaagaagcttatgatatcgtacagcctaaagcgatggaagcttgggaaacacaa
gtacaatttaaagagcttgtagaagctgatgagcgtattacaagcaagttaacacaagaa
gaaattaatgaatgcttcaactatgagcatcatatgcaacacgttgatacaatctttgaa
cgccttggattaaacgaagcgtaa

DBGET integrated database retrieval system