KEGG   Bacillus cereus ATCC 14579: BC0329Help
Entry
BC0329            CDS       T00127                                 

Definition
(RefSeq) phosphoribosylformylglycinamidine synthase II
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Module
bce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BC0329
Enzymes [BR:bce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     BC0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS AIRS_C FGAR-AT_linker CDCA
Motif
Other DBs
NCBI-GeneID: 1202682
NCBI-ProteinID: NP_830168
UniProt: Q81IQ3
Position
303642..305861
Genome map
AA seq 739 aa AA seqDB search
MSLMLEPNPTQIKEERIYAEMGLTDEEFAMVEKILGRLPNYTETGLFSVMWSEHCSYKNS
KPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGII
RDVFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGNCIGIPTVGGEVQFDPCY
EGNPLVNAMCVGLINHEDIKKGQAHGAGNTVMYVGASTGRDGIHGATFASEELSESSEAK
RPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTSSSAEMASKAGMGIEMYLDD
VPQRETGMTPYEMMLSESQERMLIVVKKGREQEIVDLFEKYDLAAVTMGKVTEDKMLRLF
HKGEKVAEVPADALAEEAPIYHKPSKEAAYFAEFQAMKMETPKVENYKETLFALLQQPTI
ASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKGLAMTTDCNSRYIYLDPEMGGKIA
VAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIEKSVDGMSEACRTLQTPVIGGNVS
MYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQAGDLVYVIGETKAEFGGSELQKMIH
GKIFGQSPSIDLDVELKRQKQVLEAIQAGLVQSAHDVAEGGLAVAISESAIGAKGLGATV
KLDGEATAALFAESQSRFVITVKRENKEAFEKVVEAIQVGEVTSTNEVTIHNEENEVLLT
ANVDEMRKAWKGAIPCLLK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaatgcttgaaccaaatccaacacaaattaaagaagagcgtatatatgcggaa
atggggttaacagacgaagagtttgccatggttgaaaagattttaggtcgtctgccaaat
tatacagaaacagggttattctctgtaatgtggtctgaacattgtagttataaaaattca
aaaccagtgcttcgaaaattcccaacaacaggtgagcgtgttctacaagggcctggggaa
ggtgctggaattgtagatatcggtgataatcaagcagttgtatttaaaatggaaagtcat
aaccatccttcagctattgaaccatatcaaggagctgcaacaggtgttggtggtattatt
cgtgacgtattctctatgggagcacgtccggtagctctattaaactcacttcgtttcggt
gaattacagtcaccacgtgtgaaatatttattcgaagaagtagtagcaggaattgcagga
tacggtaactgcatcggtattccgactgttggcggcgaagtacaatttgatccatgttat
gaaggaaatccacttgtaaatgcaatgtgcgtaggtttgattaaccacgaagacattaaa
aaagggcaagcacatggtgctggtaacacagtaatgtacgtaggagcatcaactggtcgt
gacggtattcacggtgcaacattcgcgtcggaagaactatctgaaagctcagaagcgaaa
cgtccagcggttcaagtaggggatccatttatggaaaaacttcttattgaagcgtgttta
gaattaattcaatctgatgcacttgttggaattcaagatatgggtgcggctggtttaaca
tcatcatctgcagaaatggcaagtaaagcaggaatgggtattgaaatgtacttagatgat
gtaccacagcgtgaaacaggaatgacaccatatgaaatgatgctatctgaatcacaagag
cgtatgttaattgtcgtgaaaaaaggtagagaacaagaaatagtagatttatttgagaag
tatgatcttgcagcggttacgatggggaaagtaacagaagataaaatgcttcgtttattc
cataaaggtgaaaaggtagctgaagttccagcagatgctttagcagaagaagcaccaatt
tatcataagccatcaaaagaagcagcatactttgctgaattccaagcaatgaaaatggaa
acgccaaaagtagaaaattataaagaaacgttattcgctttattacagcaaccaacaatt
gcaagtaaagagtgggtatacgatcaatacgattaccaagttcgcacaagcacagttgtt
acgccaggttcagatgctgcagttgtacgtgtacgcggtacagaaaaaggattagcaatg
acgacagattgtaactctcgctacatttatctagacccagagatgggcggtaaaattgca
gtagcagaggcagcgcgtaatatcgtatgttctggcggagagccacttgcaattacagat
tgcttaaacttcggtaacccagaaaaaccagaaatcttctggcaaattgagaaatcagta
gacggtatgagtgaagcttgtcgcacattacaaacaccagttatcggcggaaacgtatcg
atgtataacgagcgtagtggtgaagctgtatatccaacaccaactgttgggatggttgga
cttgtgcatgacttaaaacatgtaacaacacaagagtttaagcaagctggtgatttagtg
tatgtaattggtgagacgaaagctgagtttggcggaagtgaattacagaaaatgattcac
ggcaaaattttcggtcaatcaccaagtatcgatttagatgtagaattaaaacgccaaaaa
caagtattagaagcaattcaagctggtcttgttcaatctgcacatgatgttgctgaaggt
ggtttagcagttgcgatttcagaaagtgcaattggtgctaaaggcttaggtgctactgtg
aaattagatggagaagcaacagcagcattattcgctgaatcacagtctcgcttcgtgata
actgtaaaacgtgaaaataaagaggcgtttgagaaagtggtagaagcaatccaagttgga
gaagtaacaagtacaaatgaagtaacaattcataatgaagaaaatgaagtattacttaca
gcaaatgtagatgaaatgagaaaggcttggaaaggggcaatcccatgcttgctgaaataa

DBGET integrated database retrieval system