KEGG   Bacillus cereus ATCC 14579: BC0330Help
Entry
BC0330            CDS       T00127                                 

Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce00250  Alanine, aspartate and glutamate metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Module
bce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC0330
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC0330
Enzymes [BR:bce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     BC0330
Peptidases [BR:bce01002]
 Cysteine Peptidases
  Family C44
   BC0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 Pribosyltran GATase_4 GATase_2 PRTase_2
Motif
Other DBs
NCBI-GeneID: 1202683
NCBI-ProteinID: NP_830169
UniProt: Q81IQ2
Position
305846..307261
Genome map
AA seq 471 aa AA seqDB search
MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIVVNNGEKIVGHKGLGL
ISEVFSRGELEGLNGKSAIGHVRYATAGGSEVANVQPLLFRFSDHSMALAHNGNLINAKM
LRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIESVKEALNKVKGAFAYLLLTGNEMIV
ALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPGELLIINDEGIHVDRFTND
VEHAICSMEYIYFARPDSNIAGVNVHAARKNMGKRLAAEAPIEADVVTGVPDSSISAAIG
YAEATGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLSAVRGVVEGKRVVMIDDSIVR
GTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQTRKELIAANHTVEEIREMIGA
DSLTFLSEDGLVDAIGRPYEGKYGGLCMAYFNGDYPTALYDYEQELLESMK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgaaataaaggggttaaacgaagaatgtggcgttttcggaatttgggggcat
gaaaatgcagcacaagtttcatactacggattgcacagtttacagcaccgtgggcaagaa
ggcgcaggcattgtcgtaaataatggggaaaaaatcgtcggtcacaaggggttaggttta
atatcagaagtgttttcaagaggtgagctagaaggattaaatggaaaatcagcgatcgga
catgtacgatatgcaacagctggtggaagtgaagttgctaacgttcaaccattgttgttc
cgtttttccgatcatagtatggcgttagctcataacggaaatttaattaacgcaaaaatg
cttcgtcgtgaattagaagcagagggcagtatttttcaaactagttcagatacagaagta
cttttacatcttattaaacgtagtacgaaagattctttaattgaaagtgtaaaagaagct
ttaaacaaagtgaaaggtgcgtttgcgtatcttttactaactggaaatgaaatgatcgtt
gcattagatccgaatgggttccgtccgctttcaattggaaagatgggggatgcttacgtt
gtagcatctgaaacatgtgcttttgatgtagtaggtgcaacatacattcgtgatgtagaa
ccgggtgaattacttatcattaatgatgaaggaattcacgtagatcgtttcacaaacgat
gtagaacatgcaatttgtagtatggaatacatttactttgcacgaccagattctaatatt
gcaggcgttaacgttcatgcagcacgtaagaatatggggaaacgtttagcggcagaagct
cctattgaagcagatgttgttactggtgtaccagactctagtatttcagctgcgattggc
tatgcggaggcgacaggtattccatatgagttaggattaattaaaaatcgttacgttgga
cgtacgtttattcaaccttctcaggaactgcgagagcaaggggttaagatgaaactttcc
gcagtaagaggtgtagttgaagggaaacgagttgttatgattgatgactctatcgtaaga
ggaacgacaagtaaacgaattgttcgtatgcttcgtgaagctggagcgacagaagttcac
gtaagaattgcttcaccacctctgaaatatccatgtttctatggcattgatattcaaacg
agaaaagaattaattgcagcaaatcatacagtagaagaaatccgtgaaatgatcggagca
gattctttaacatttttaagcgaagatggattagtagatgcaattggacgtccatatgaa
gggaaatatggtggcctatgcatggcttactttaatggggactatccaacagctctttat
gattatgagcaagagcttttagaaagtatgaaataa

DBGET integrated database retrieval system