KEGG   Bacillus cereus ATCC 14579: BC0333Help
Entry
BC0333            CDS       T00127                                 

Gene name
purH
Definition
(RefSeq) bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce00670  One carbon pool by folate
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Module
bce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BC0333 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BC0333 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bce04147]
    BC0333 (purH)
Enzymes [BR:bce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     BC0333 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     BC0333 (purH)
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC0333 (purH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-GeneID: 1202686
NCBI-ProteinID: NP_830172
UniProt: Q81IP9
Position
309016..310551
Genome map
AA seq 511 aa AA seqDB search
MKKRALVSVSDKTGVVEFVKGLLEQGIEVISTGGTKKLLEENGLQVIGISEVTGFPEIMD
GRVKTLHPNIHGGLLAVRDNETHVTQMNELGMEPIDFVVVNLYPFKETIAKPDVTFADAI
ENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDIVLAELKENGEVAEETKRKLAAKVFRHTA
AYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKATFYKAPFAATSSVAYAEQ
LHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVGVGTDIHEAYTRAYEADPVS
IFGGIIAANREIDKATAEKLHEIFLEIVIAPSFSQEALEVLQSKKNLRLLTINIEKATSA
SKKLTSVQGGLLVQEEDTLSLDESTISIPTKREPSEQEWKDLKLAWKVVKHVKSNAIVLA
KDDMTIGVGAGQMNRVGSAKIAITQAGEKAQGSALASDAFFPMPDTLEEAAKAGITAIIQ
PGGSIRDEDSIKVADTYGIAMVFTGVRHFKH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgtgcattagtaagtgtttcagataaaacaggagtagtagaatttgttaaa
gggttactagaacaagggattgaagttatttcaacaggtggtacgaaaaagttattagaa
gaaaacggtttacaagtaattggtatttctgaagtaactggtttccctgaaattatggat
ggccgtgtgaaaacgttacatccaaatattcatggtggtctattagcagttcgtgataat
gaaacacatgtaacacaaatgaatgaattaggtatggagccaattgactttgttgttgtt
aacttatatccatttaaagaaacaatcgctaagcctgatgtaacatttgctgatgcaatt
gaaaatattgatatcggtggcccgacaatgattcgctctgctgcgaaaaatcataaattc
gtatctgtaattgtagatccagtagattatgatattgtgttagcagaactgaaagagaac
ggtgaagtagcagaggaaacaaaacgtaaactagcagcgaaagtattccgtcatacagca
gcgtatgatgcgttaatttctaactacttaacagagcaaatgggtgaagaaagtccagaa
acattaactgtgacatttgagaaaaagcaagacttacgttatggcgagaacccacatcaa
aaggcaactttctataaagcgccattcgcggcaacttcttctgttgcatacgcagaacaa
ttacacggtaaagaattatcgtataacaatattaatgatgcagacgcagcacttagcatc
gtaaaagaatttacagaaccagcagtagtagcagtaaaacatatgaatccatgtggtgtt
ggagtaggaactgatattcacgaagcatatactcgcgcttatgaagcagatccagtatca
attttcggcggtattattgcagcaaatcgtgaaattgataaagctacagcagaaaagtta
catgaaattttcttagaaattgttatcgcaccttcgttctcgcaagaagctttagaagtg
ttacaaagtaagaagaacttacgtttattaactataaatattgaaaaagcgacaagtgca
agcaaaaaactaacttctgtacaaggtggacttctcgttcaagaagaagatacgttatca
ttagatgaaagtacaatttcaattccaacgaaacgtgaaccttcagagcaagaatggaaa
gatttaaaactagcttggaaagttgtaaaacatgtgaaatcaaacgcaattgttttagcg
aaagatgacatgacaattggcgtcggtgcgggacagatgaaccgtgtaggttctgcaaaa
atcgcaattacacaagctggtgaaaaagcacaaggtagcgcacttgcatctgatgctttc
ttcccaatgccagatacattagaagaagcagcaaaagcaggaattacagcaatcattcaa
ccaggcggatcaatccgtgatgaagattctattaaagtggcagatacttatgggattgct
atggtgttcactggcgtacgtcatttcaaacactaa

DBGET integrated database retrieval system