KEGG   Bacillus cereus ATCC 14579: BC0334Help
Entry
BC0334            CDS       T00127                                 

Definition
(RefSeq) phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Module
bce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BC0334
Enzymes [BR:bce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     BC0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 ATP-grasp_2 ATPgrasp_Ter RimK ATP-grasp_5 Dala_Dala_lig_C DUF4390
Motif
Other DBs
NCBI-GeneID: 1202687
NCBI-ProteinID: NP_830173
UniProt: Q81IP8
Position
310974..312245
Genome map
AA seq 423 aa AA seqDB search
MNVLVIGRGGREHALAWKFAQSEKVEKVYVAPGNEGMRDVATPVDIDENDFDALVLFAKE
NNVELTFVGPEIPLMNGIVDCFKEEGLRVFGPNKAAAVIEGSKAFTKELMKKYDIPTAAY
ETFTDYEEAVQYIQKVGAPIVIKADGLAAGKGVTVAMTLEEALQAVKEMLQDVKFGAASK
KIVIEEFLDGQEFSLMAFVNGTTVHPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQIPES
AVQEAIQTVLHPTAKAMIAENRSFTGILYAGLILTNDGPKVIEFNARFGDPETEVVLPRL
ENDLVDVCNAVLDESELTLQWSEEAVIGVVLASKGYPEAYKKGDIISGLDALQDVIVFHA
GTAMKHGDFVTNGGRVLFVACKANSLQEAKDKVYKEIGKIESDGLFYRSDIGYRAIGHEM
TKS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttttagtaattggccgcggtgggcgtgagcatgctttagcttggaagtttgca
caatctgaaaaagtagaaaaggtatatgtagcaccaggtaatgaaggtatgagagatgtt
gcaacaccagttgatattgatgaaaatgattttgatgcattagttttatttgcaaaagag
aataatgttgagttaactttcgttggaccagaaattccgcttatgaatggaattgttgat
tgttttaaagaagagggacttcgcgtatttggtccgaataaagcggctgctgttattgaa
ggtagtaaagcttttacaaaagagcttatgaaaaagtatgatattccaactgcggcgtac
gaaacttttacagattatgaagaagcagtacagtacattcaaaaagttggtgcaccaatc
gttattaaagctgacggcctagctgcgggtaaaggggtaacggtagcaatgacgcttgaa
gaggcattacaagctgtgaaagaaatgctacaagatgtgaaattcggcgcggcaagtaag
aagatcgttattgaagagtttttagatggacaagaattttcattaatggcattcgtgaat
ggaacaactgtacatccaatggtaatcgcccaagatcataaaagagcttttgatggtgat
aaaggtccaaatacgggcggaatgggtgcatattctccagtaccacaaattccagaatca
gcagttcaagaagcgattcaaaccgtattacatccaactgctaaggcgatgattgcagaa
aaccgttcgtttacaggtattttatacgcaggtcttattttaacaaatgatggtccgaag
gtaattgaatttaatgcacgcttcggtgatcctgaaacagaagttgtattacctcgctta
gaaaatgatttagttgacgtatgtaacgctgtattagatgaaagtgaactaacgttacaa
tggtcagaagaagctgtaatcggtgttgtacttgcttctaaaggatatccagaagcatat
aaaaaaggtgatattattagtggactagatgcactgcaagatgtgattgttttccatgca
ggtacagcaatgaaacatggggactttgtaacgaacggtggccgtgtattatttgttgct
tgtaaggcaaatagtttacaagaagcaaaagataaagtatataaagaaatcggtaaaatt
gagagtgatggtctattttatcgaagtgatataggatatcgtgcaattgggcatgagatg
acgaaaagttaa

DBGET integrated database retrieval system