KEGG   Bacillus cereus ATCC 14579: BC0336Help
Entry
BC0336            CDS       T00127                                 

Definition
(RefSeq) somatin-like protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 Band_7_1
Motif
Other DBs
NCBI-GeneID: 1202689
NCBI-ProteinID: NP_830175
UniProt: Q81IP6
Position
complement(312462..313307)
Genome map
AA seq 281 aa AA seqDB search
MKEKQVFYVNGFLGIIGILILAAIGVFFLAQEIFIGAALTIILAAVLATGIGIVQPNQAK
VITFFGNYLGTIRQNGLFLTIPFAFRQTVSLRVENFNSKKLKVNDVDGNPIEIAAVIVYK
VVDSAKAMFGVEHYDRFVEIQSETAIRHVATKYPYDNFQDETCVTLRGNTEEISEELKRE
LEARLEIAGVEVLETRLTHLAYATEIAHAMLQRQQAKAVLAARKEIVEGAVKMAKDSIHM
LDEEGVLELDDERKANMVNNLLVAIVSDKGAQPVINTGSLY
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaacaagtattttatgtaaatggttttctcggtattattggaattttgatt
ttagctgctatcggtgtatttttccttgcacaagaaattttcataggagcggcactaact
attatattagccgcagttctcgctacaggtatcggtattgttcaaccgaatcaagcgaag
gttattacgttcttcggtaattatttaggaacaattcgtcaaaacggtttatttttaacg
attccgttcgcattccgtcaaactgtatctttacgtgttgaaaactttaacagtaaaaaa
ttaaaagtaaatgacgttgatggaaatccaattgaaattgcagctgttatcgtatataaa
gttgttgattctgcaaaagcaatgtttggtgttgaacattatgatcgatttgtagaaatt
caaagcgaaacggcaatccgccatgttgcaacaaaatatccttatgacaatttccaagat
gaaacctgcgttacgttacgcggaaatactgaagaaatctctgaagaattaaaacgtgag
ttagaggcgcgtcttgaaattgctggtgtagaagtattagaaactcgtttaacgcactta
gcttacgcaacagaaattgcccatgcaatgctacaacgccagcaagcaaaagcagtatta
gctgctagaaaagaaattgttgaaggtgctgtgaagatggcgaaagattccatccatatg
ttagatgaagaaggcgtactagaactcgatgacgagcgtaaagcaaatatggtaaacaac
ttattagttgccatcgtttcagataaaggtgcgcaaccagttattaatacaggaagccta
tactaa

DBGET integrated database retrieval system