KEGG   Bacillus cereus ATCC 14579: BC0339Help
Entry
BC0339            CDS       T00127                                 

Definition
(RefSeq) geranylgeranylglyceryl phosphate synthase-like protein
  KO
K07094  putative glycerol-1-phosphate prenyltransferase [EC:2.5.1.-]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC0339
Enzymes [BR:bce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     BC0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PcrB Trp_syntA His_biosynth Aldolase BtpA
Motif
Other DBs
NCBI-GeneID: 1202692
NCBI-ProteinID: NP_830178
UniProt: Q81IP4
Position
314242..314931
Genome map
AA seq 229 aa AA seqDB search
MYDISGWKHVFKLDPNKELSDEHLEMICESGTDAVIVGGSDGVTIDNVLHMLVSIRRYAV
PCVLEVSDVEAITPGFDFYYIPSVLNSRKVEWVTGVHHEALKEFGDIMDWDEIFMEGYCV
LNPEAKVAQLTEAKCDLTEDDVIAYARLADKLLHLPIFYLEYSGTYGDVELVKNVKAELK
QAKLYYGGGISNAEQAKEMAQYADTVVVGNIIYDDIKSALKTVKAVKGE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatatttccggatggaaacatgtatttaagcttgatccaaataaggagttaagc
gatgaacatttagaaatgatttgtgagtctggaactgatgcggttattgtaggcggaagt
gatggagttacaattgataacgtattacacatgctagttagcattcgtagatatgcagtt
ccttgtgtattagaggtttctgatgtagaagcaattacaccaggatttgatttttattac
atcccaagtgttttaaatagccgaaaagtagaatgggtaacaggtgttcatcatgaggca
ttgaaagaatttggggatattatggactgggacgaaatttttatggaagggtattgtgtt
ttaaatccagaagcgaaagtagcccagcttacagaagcgaaatgtgatttaacagaagat
gacgttattgcatatgctcgtttagcagacaagttattacatttaccgatattttattta
gaatatagcggtacgtatggagatgttgaacttgttaaaaatgtaaaagcagaattgaaa
caagctaagttatactatggcggtggtatttctaatgcagaacaggcgaaagaaatggca
caatatgctgatacagtagttgttggaaatattatttatgatgatataaaatcggcgtta
aaaacagttaaagcagtaaaaggagagtag

DBGET integrated database retrieval system