KEGG   Bacillus cereus ATCC 14579: BC0357Help
Entry
BC0357            CDS       T00127                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase [NADP+]
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00250  Alanine, aspartate and glutamate metabolism
bce00310  Lysine degradation
bce00350  Tyrosine metabolism
bce00650  Butanoate metabolism
bce00760  Nicotinate and nicotinamide metabolism
bce01100  Metabolic pathways
bce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BC0357
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC0357
   00310 Lysine degradation
    BC0357
   00350 Tyrosine metabolism
    BC0357
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BC0357
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BC0357
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     BC0357
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     BC0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2884 DUF1487
Motif
Other DBs
NCBI-GeneID: 1202710
NCBI-ProteinID: NP_830196
UniProt: Q81IM7
Position
336130..337581
Genome map
AA seq 483 aa AA seqDB search
MDKKATFVSIDKKAMYINGEWITLQEQIEVNNPATKEIFATVPKGGVTEAKQAVDAAHEA
FKTWSKLTAADRATKLKKWFTLIDENKEEIAAIMTKEQGKPFAEALGEVNYANSFVEWYA
EEGKRVYGEMIPAAHPNKRILVMKQPVGVMAAITPWNFPAAMITRKVAPALAAGCTAVVK
PASQTPLTALKLAELAHEADIPKGVINIITGSAKAIADTWMEDGRVRKVSFTGSTEIGKE
LMASAAQTMKKVSLELGGHAPFIVMNDADLDKAVEAVIGSKFRNAGQTCICTNRVFVQEE
VYEVFVEKFQKAVGQLKVGDGFGDGTTVGPLIDENAVSKVQEHIEDAIQKGGTVLYGGQK
VAELEGHFIQPTVIGLANDTMLCMNEETFGPVAPVAKFKTVDEVIERANNTPYGLAAYIF
TKDISQAFQISEALEYGIIGLNDGLPSVAQAPFGGFKESGIGREGGHFGIEEYLEIKYIS
LGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaaaggcgactttcgtaagtatagataaaaaggcgatgtatataaatggtgag
tggattacactacaagaacaaattgaagtaaataatcctgcgacgaaggaaatatttgca
actgtaccaaaaggcggagtaacagaggcaaagcaagctgttgatgctgcacatgaagct
tttaaaacgtggtctaagttaacggcagcagatcgtgcaacgaagttaaaaaagtggttt
acgcttattgatgaaaataaagaagagatcgcagcgattatgacgaaggaacaagggaag
ccgtttgcagaagcgcttggtgaagtaaattatgcaaacagttttgttgaatggtatgca
gaagaggggaaacgcgtatatggtgaaatgattcctgctgctcatccgaataagcgcatt
ttagttatgaagcaaccagttggcgttatggcagctattacaccttggaacttcccagct
gctatgattacgagaaaggtagccccagcgcttgcagcaggctgtacagccgttgtgaaa
ccggcaagtcaaacgccattaactgcattgaaattagctgaattagcccatgaagcagat
attccaaagggcgtaatcaatatcataacaggtagtgcaaaagcaattgctgatacatgg
atggaagatggtcgcgttcgaaaagtgtcctttacagggtcaacggaaatcgggaaagag
ttaatggctagtgcggcgcaaacgatgaaaaaagtttcgcttgagttagggggacacgct
ccgtttatcgtaatgaatgatgcagatttagataaagcagtagaagcggtgattggttcg
aaattccgtaatgcaggacaaacgtgtatatgtacaaaccgagtattcgttcaagaagaa
gtatacgaagtatttgtagagaagttccaaaaggcagtagggcagttgaaagtaggagac
ggtttcggtgacggaacgactgtcgggccacttattgatgagaatgcagtttcaaaagta
caagaacatattgaagatgctattcaaaaaggtggaacagttttatatggtggtcaaaag
gtcgcagagttagagggacatttcattcaaccgactgtaattgggttggcaaatgatacg
atgctttgtatgaatgaagaaacatttgggccagtggcaccagttgcgaaatttaaaaca
gttgatgaagtaatcgaacgtgcaaacaatacaccatacggtttagctgcgtatattttc
acgaaagacattagccaagcattccaaattagtgaagcgttagagtacggtattatcggt
ctaaacgatggtcttccatcagttgcacaagcaccatttggtggatttaaagaaagtggt
atcggtcgtgaaggaggccatttcggcatcgaggaatatttagaaattaaatatatttca
ttgggactataa

DBGET integrated database retrieval system