KEGG   Bacillus cereus ATCC 14579: BC0360Help
Entry
BC0360            CDS       T00127                                 

Definition
(RefSeq) aminopeptidase
  KO
K19689  aminopeptidase [EC:3.4.11.-]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bce01002]
    BC0360
Enzymes [BR:bce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     BC0360
Peptidases [BR:bce01002]
 Metallo Peptidases
  Family M29: aminopeptidase T family
   BC0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M29
Motif
Other DBs
NCBI-GeneID: 1202713
NCBI-ProteinID: NP_830199
UniProt: Q81IM4
Position
complement(338622..339851)
Genome map
AA seq 409 aa AA seqDB search
MSFEQTLEKYAALAVNVGVNIQPGQTLSISAPLEAVQFVRLVTEKAYKSGAKHVYVDWND
ETLTRLKFDLAPEEAFAEFPSWKAHAREELAKEGAAFMSIYAENPDLLKGVEASRIATAH
KVAGEAMKVYRDYVQADKVSWCVISVPTKEWAAKVFPDVAPEEQEAKLWDAIFKATRADL
ENPVEAWKEHDETLHTKVDYLNEKHYKALHYTGPGTDLTIELPEKHVWAGAGSLNEKNVP
FMANIPTEEVFTMPLKTGVNGQVSSTKPLVFAGNIIDNFTLTFENGRIVDYKAEAGEEAL
KHLVETDEGSHFLGEVALVPHDSPISNTNVLFYNTLFDENASCHLAIGNAYAFNLVGGKT
MSKEELAENGANASITHNDFMIGSAELDIDGITADGRHEPIFRKGNWAF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaacaaacgttagagaaatatgctgctcttgcagttaatgttggtgttaat
attcaacctggacaaactttatcaattagtgcacctcttgaagctgtacaatttgtacgc
ctcgttacagaaaaagcatataaatctggtgcaaaacacgtatatgtagattggaatgat
gagacgttaacacgcttaaagttcgatctagctcctgaagaagctttcgctgaatttcca
tcttggaaagcacatgctcgtgaagaattagcaaaagaaggcgctgcatttatgtctatc
tatgcagaaaaccctgatttattaaaaggtgtagaagcatcgcgtattgcaacagctcat
aaagtagctggagaagcaatgaaagtataccgtgattacgtacaagcagataaagtaagt
tggtgtgtcatttctgttcctacgaaagaatgggctgcgaaagtattccctgacgtagcg
ccagaagaacaagaagcaaagttatgggatgctattttcaaagctactcgtgctgattta
gaaaatcctgtcgaagcatggaaagaacatgatgaaacattacatacaaaagtggattac
ttaaacgaaaagcattataaagctcttcactatacaggtcctggaacagatttaacaatc
gaacttccagaaaaacatgtatgggctggtgctggtagcttaaatgaaaagaacgtacca
tttatggctaatattccaactgaagaagtatttacaatgccacttaaaacaggtgtaaac
ggccaagtttctagtacaaaaccgttagtatttgcaggtaatattatcgataatttcacg
ttaacatttgaaaacgggcgtatcgtagactataaagctgaagctggtgaagaagcttta
aaacatttagtagaaacagatgaaggttctcacttcttaggagaagtagctttagtacct
catgactcaccaatttcaaacacaaatgttttattctacaatacactatttgacgaaaat
gcatcttgccaccttgcaatcggaaatgcttatgcatttaacttagttggcggaaaaaca
atgtctaaagaagaacttgctgaaaacggcgcaaacgctagtatcacacacaacgacttc
atgattggatcagctgagcttgatattgacggtattactgctgatggcagacatgagcct
atcttccgtaaaggtaactgggcgttttaa

DBGET integrated database retrieval system