KEGG   Bacillus cereus ATCC 14579: BC0363Help
Entry
BC0363            CDS       T00127                                 

Definition
(RefSeq) nucleoside ABC transporter permease nupC
  KO
K03317  concentrative nucleoside transporter, CNT family
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate
Motif
Other DBs
NCBI-GeneID: 1202716
NCBI-ProteinID: NP_830202
UniProt: Q81IM1
Position
complement(342347..343543)
Genome map
AA seq 398 aa AA seqDB search
MQYVMSIIGIIAVLGLCFALSNNKSKINFRAIAIMIGFQILIGWFMFATKIGQQIIIFIS
KVFNKLIKLGTTGVDFLFNGIHRDFVFFLNVLLIIVFFSALLSIFSYLGVLPFIVRVVGG
AISKITGLPRVESFHAVNSVFFGSSEALIVIKNDLQHFNKNRMFIICCSAMSSVSASVTA
SYVMMLDAKYVLAALPLNLFSSLIVCSLLTPVDTKKEDEVIQKFDRTLFGDSFIGAMING
ALDGLKVAGIVAALMIAFIGVMEVVNYVISAASGAMGHAVTLQQIFGYVLSPFAFLMGIP
TQDIIPAGGIMGTKIVLNEFVAILDLKDTATTLAPRTVGIVTVFLISFASISQIGAIVGT
IRALSEKQGSVVSKFGWKMLFASTLASILSATIAGLFI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtaatgagcattatcggtattattgccgtgttaggtttatgttttgctttg
tcaaacaacaaaagtaaaatcaacttccgtgcaattgcaattatgattggtttccaaatt
ttaatcggttggtttatgtttgctacaaagattggtcaacaaatcattattttcattagt
aaagttttcaacaaactaattaaacttggtacgacaggtgtcgattttctctttaatgga
attcacagagattttgtctttttcttaaacgtattattaattatcgtatttttctcagca
ctactttcaatctttagttatttaggtgttttaccattcatcgttcgcgttgtcggcggt
gctatttcaaaaattactggtttaccacgtgttgagtcattccacgcagtaaactctgta
ttcttcggttcaagtgaagcgttaatcgttattaaaaacgatttacagcatttcaataaa
aaccgtatgtttatcatttgttgttctgcgatgagctccgtttctgcttctgttacagca
tcatacgtaatgatgttagatgcaaaatacgtactggcagctcttccgctaaacttattc
tcaagcttaatcgtttgttcgttattaacaccagttgatacgaagaaagaagatgaagtg
attcagaaatttgatagaactctattcggagacagctttatcggcgcaatgattaacggt
gcgcttgatggtttaaaagtagctggtatcgttgccgcattaatgatcgcctttatcggt
gtgatggaagttgtaaactacgtaattagtgcagcttcaggcgcaatgggacatgctgtt
actttacaacaaatcttcggttacgtactttctccattcgcattcttaatgggtattcca
actcaagatattatcccagctggtggtattatgggtacgaagattgttttaaatgagttt
gtagcaatccttgatttaaaagacacagctacaacattagctccacgtacagttggaatc
gttacagtattcttaattagcttcgcaagtattagccaaattggtgcaatcgttggtaca
atccgtgccctttctgaaaaacaaggaagcgttgtttctaaatttggttggaaaatgcta
tttgcatcaacacttgcttctattttatctgcgacaatcgctggattgtttatttaa

DBGET integrated database retrieval system