KEGG   Bacillus cereus ATCC 14579: BC0364Help
Entry
BC0364            CDS       T00127                                 

Definition
(RefSeq) tRNA (Uracil-5-)-methyltransferase
  KO
K03215  23S rRNA (uracil1939-C5)-methyltransferase [EC:2.1.1.190]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bce03009]
    BC0364
Enzymes [BR:bce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.190  23S rRNA (uracil1939-C5)-methyltransferase
     BC0364
Ribosome biogenesis [BR:bce03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    BC0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_U5-meth_tr Methyltransf_31 TRAM Met_10 Methyltransf_25 Methyltransf_11 MTS PrmA Methyltransf_15 Methyltransf_23 Cons_hypoth95 Methyltransf_32 TPMT DOT1 RrnaAD N6_N4_Mtase Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 1202717
NCBI-ProteinID: NP_830203
UniProt: Q814A6
Position
343969..345345
Genome map
AA seq 458 aa AA seqDB search
MSTKMTPPVEKNEFIDVVFEDLTHDGAGVAKVKGYPIFVKNGLPGEEAQIKIIKVKKNFA
FGRLMKLHTESPYRKDAECPVYNQCGGCQLQHLTYEGQLQAKEKQVRDVMQRIGGLADVP
VHPVLGMKNPWVYRNKAQVPIGEREGGLVAGFYRQGTHDIINMESCLIQAEENDTLIQEV
KRICEKHGITAYNEERNKGTLRHVMARYGQVTGEIMLVFITRTAELPNKKAIIEEIAAKF
PEVKSIVQNVNTKRTNVIFGDKTTVLYGSEYIYDFIGDIKFAISARSFYQVNPEQTKVLY
DKTLEYAKLNGNETVIDAYCGIGSISLFLAQKAKKVYGVEIVPEAIEDANRNAALNNMTN
AEFGVGEAEVVIPKWYKEGVIADTMVVDPPRKGCDEALLNTIIDMKPNRVVYVSCNPATL
ARDLKVLEEGGYKTQEVQPVDMFPHTTHVECVAWLKLV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtactaaaatgacgccaccagttgagaaaaacgagtttatagatgtagtatttgaa
gatttaacacatgatggtgccggtgttgcgaaagtaaagggctatcctattttcgttaaa
aacggattaccaggtgaagaagcgcaaattaaaattattaaagtgaagaaaaacttcgca
tttggtcgtttaatgaagcttcatacagaaagtccatatcgtaaagatgctgaatgccca
gtatataatcagtgcggcggttgtcagcttcagcacttaacttatgaaggacaattacaa
gcgaaagaaaaacaagtacgtgacgttatgcagcgtatcggaggactagctgatgttcct
gttcatcctgtacttggcatgaagaatccgtgggtataccgtaataaagcacaagtacca
atcggagaacgtgaaggcggacttgtagctggtttttatcgccaaggaacgcatgacatc
attaatatggaatcatgcttaattcaggcagaagaaaacgatacattaatccaagaagta
aaacgtatttgtgaaaagcacggtatcactgcgtacaacgaagagcgtaacaaaggaaca
cttcgtcacgtaatggctcgttacggacaagtaacaggggaaattatgcttgtcttcatt
acgcgtacagcagaattgccgaacaaaaaagcaattattgaagaaattgcagcgaaattc
ccagaagtaaaatcaattgttcaaaacgtaaatacgaagcgtacgaatgtaattttcgga
gacaaaacgacagtactgtacggatcagaatacatttatgactttatcggtgacattaaa
tttgcgatttcagcacgttcattctatcaagtaaacccagagcaaacgaaagtgctttac
gataaaacgttagaatacgcaaaattaaatggtaacgaaacagtaatcgatgcctattgc
ggaatcggatcaatctcgttattcctagcgcaaaaagcgaaaaaagtgtacggcgttgaa
atcgtcccagaagcaatcgaagacgcaaaccgaaacgcagcactaaacaacatgacaaac
gctgaatttggcgtaggagaagcagaagtagtcattccaaaatggtacaaagaaggcgta
atcgccgacacaatggtcgtagacccaccgcgtaaaggctgtgacgaagcattactaaac
acaatcatcgacatgaagccaaaccgcgtcgtatacgtatcatgtaacccagcaacatta
gcacgtgatttaaaagtactagaagaaggcggatataaaacgcaggaagtacaacctgtt
gatatgttcccgcatacgacgcatgtggagtgtgtggcttggcttaagttagtataa

DBGET integrated database retrieval system