KEGG   Bacillus cereus ATCC 14579: BC0368Help
Entry
BC0368            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1456
Motif
Other DBs
NCBI-GeneID: 1202721
NCBI-ProteinID: NP_830207
UniProt: Q814A5
Position
349078..349596
Genome map
AA seq 172 aa AA seqDB search
MAMSNNDILKRVRYALDIRDIDMVEIFKLGGMEVTKEDVVDMLTKIKRAPQHEAENDEVA
EDEYVLTCDMMMLEAFLNGFITLKRGKQDPKPGQPAPVQSKESANNLLLKKMKIALSLTS
EDVLDILDSVGVTVTKGELGALLRKKGHKNYKECGDRYARNFIKGLGVKYRG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgagcaacaacgatatattaaaaagagtacgatacgctttagacataagagat
atagatatggtggaaatctttaaacttggcgggatggaagtaacgaaagaagacgtagtt
gatatgcttacaaaaataaagagggctcctcagcatgaagctgaaaatgatgaggtagct
gaagatgagtacgtattaacgtgcgatatgatgatgttagaggcatttttaaatggattt
attactttaaaaagaggaaagcaagatccgaaaccagggcagcctgcacctgtacagagc
aaggagagtgccaataaccttcttctaaagaaaatgaaaatcgcactatctttaacgagt
gaggatgtacttgatatattagatagcgtaggcgttacggtaacaaaaggagagttaggc
gctctattaagaaagaaaggccataaaaattacaaagagtgcggcgatagatacgcaagg
aatttcattaagggattaggtgtaaagtatagaggataa

DBGET integrated database retrieval system