KEGG   Bacillus cereus ATCC 14579: BC0370Help
Entry
BC0370            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_CG
Motif
Other DBs
NCBI-GeneID: 1202723
NCBI-ProteinID: NP_830209
UniProt: Q81IL6
Position
complement(350619..351314)
Genome map
AA seq 231 aa AA seqDB search
MTVLYKGTLKQNNESFHVTLLSLEHIEQILSLQNIVVETLEDKSRLQPLSQEEFQYILEG
NGMMIGAFIENELIAFRALLVPPIDDEHLGLDIGLSESELHRVIYQEISNVHPNCRGNGM
QKILANVIMDELQKEDSKYDYVCCTVAPFNIPSLKDKFAQGMAIAALKEKYGGSLRYVFV
KKLRGDKESDWTDIQSILMSDASGQQALLSEGYLGYEMEKTADTFIVKFGR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacagttctatacaaaggaacattaaaacaaaataacgaatcatttcacgttacatta
ctatcactagagcacatcgaacaaattttatcactacaaaacatcgtagttgaaacacta
gaagataaaagtcgtttacaaccactctcacaagaagaatttcaatacattctagaagga
aacggcatgatgatcggtgcttttatcgaaaacgaactcatcgcatttcgcgctctactc
gtccctcctatcgacgatgaacatttagggcttgatattggtctatcagaaagtgaactg
caccgcgtcatctatcaagaaatctcaaacgttcatccgaactgccgaggaaatgggatg
caaaaaatattagcaaacgtcatcatggacgaattacaaaaagaagatagcaaatatgat
tatgtatgctgcaccgttgctccttttaacatcccgagtttgaaggataagtttgcgcaa
gggatggcgattgctgcgctaaaggagaagtatggtggtagtctgcggtatgtttttgtg
aagaaattgcgcggagataaagaaagcgattggacggatattcaaagtattctaatgagt
gatgctagtggacagcaggctttgctttcggaggggtatcttgggtatgagatggagaaa
acagcagatactttcattgtgaagtttgggcgataa

DBGET integrated database retrieval system