KEGG   Bacillus cereus ATCC 14579: BC0373Help
Entry
BC0373            CDS       T00127                                 

Definition
(RefSeq) Na+/H+ antiporter NnaC
  KO
K03315  Na+:H+ antiporter, NhaC family
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bce02000]
    BC0373
Transporters [BR:bce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BC0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_antiporter CitMHS
Motif
Other DBs
NCBI-GeneID: 1202726
NCBI-ProteinID: NP_830212
UniProt: Q81IL3
Position
complement(353792..355213)
Genome map
AA seq 473 aa AA seqDB search
MKKEIPFGIAIIPIIITVAVMMVTIVVLKQTPHVPLIIGTTVASIVAWRYGYKWNDLEEA
MYKGIRLALPAIVIIILVGLTIGAWIGGGIVATMIYYGLKLLTPSLFLVSITVICSIVAL
AIGSSWSTMGTIGVAGMGIGLSMGIPAPMVAGAIISGSYFGDKMSPLSDTTNLAAGLTNT
DLFAHIRHMLFTTVPGLIITLIVYAVLGRSFGANNIDAKSIDQTLQVLQQNFVISPFLLI
IPVVVMVLVAKKVPAIPAILVGIILGFLSQVFIQGGSVSASVGALQAGFVIDTGNKLVDE
LFNRGGLDSMMNTVSMTIVAMTFGGVLEHTGILRSIVNQILKLAKSAKGLIASTIASCFA
TNLTCSEQYISIVVPSRMYANAYTEKGLHSKNLSRALEDGGTLTSVFVPWNTCGVFILAT
LGVGAFEYAPYAILNFIVPIISIIYGITGFTIVKLSDIEKAELLKKQKAQLEA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaataccttttggaatagcgattatccctattatcattaccgttgcagtt
atgatggttacaattgttgtattaaaacaaacccctcacgttccacttattattggtaca
accgttgcttctattgtcgcttggcgttacggttacaaatggaatgatcttgaagaagca
atgtataaagggattcgtcttgcattacccgctatcgtcattattattcttgttggctta
acaattggtgcttggattggcggtggaatcgtcgcaacgatgatttattacggtttaaaa
cttttaactccatcactatttttagtttccattaccgtcatttgttctatcgtagcatta
gcaattggtagctcttggtctacaatgggcacaattggtgttgctggaatgggaattggc
ctaagtatgggaattccagctccaatggttgctggtgccattatttcaggctcttatttt
ggcgataaaatgtcaccgctttcagacacaactaacttagccgcaggattaacaaataca
gatttattcgcacacattcgtcatatgttatttactacagttccaggtttaattattact
cttatcgtctacgcggtcttaggaagaagcttcggcgctaacaatattgatgcgaagagc
atcgatcaaacgttacaagtattgcaacaaaactttgttatctcacctttcctactcatt
atacccgtagtcgttatggtattggtcgctaaaaaggtccctgccataccagcgattctc
gtcggtattattttaggatttttatcacaagtctttattcaaggtggttctgtatcagca
tctgtcggtgcactccaagctggatttgttatagacactggaaacaagctagtagacgaa
ctatttaaccgcggtggcttagattcgatgatgaatacagtctcgatgacaattgtcgct
atgactttcggaggagtattagaacatacaggtattcttcgctcaattgtaaatcagatt
ttaaagttagcgaaatcagcaaaagggcttatcgcttctactatcgcatcttgttttgca
acaaaccttacttgctctgaacaatatatttcaattgttgtcccttcaagaatgtacgca
aatgcatacacagaaaaaggactacattcaaaaaacttatccagagcattagaagatggc
ggaacattaacttctgtcttcgttccttggaatacgtgcggtgtatttattctcgctaca
cttggcgtaggtgcatttgaatatgccccttatgctattttgaatttcatcgtacctatt
atctcaatcatttatggtataacaggcttcacaattgtaaaactatcagacattgaaaaa
gcagaactactaaagaaacaaaaagctcaactagaagcttaa

DBGET integrated database retrieval system