KEGG   Bacillus cereus ATCC 14579: BC0374Help
Entry
BC0374            CDS       T00127                                 

Definition
(RefSeq) amidohydrolase
  KO
K14665  amidohydrolase [EC:3.5.1.-]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bce01002]
    BC0374
Enzymes [BR:bce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BC0374
Peptidases [BR:bce01002]
 Metallo Peptidases
  Family M20
   BC0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 1202727
NCBI-ProteinID: NP_830213
UniProt: Q81IL2
Position
355507..356622
Genome map
AA seq 371 aa AA seqDB search
MKTLELQERLTEIFQHLHENPEVSWKEYETTAYITDFLKEEGISYRTFDDCPGVIAEIGG
GNPVIAIRADMDALWQEVNGEFKANHSCGHDAHMTIVMGLILQLKNMRWKSGTVRFIFQP
AEEKGNGALKMVEKGAVDDADFLFGVHLRPIEELSLKQAAPSIRHGAAGFLEGMIHGEDA
HGARPHQGVNAIDVISMINIGLKNIWLPPQSSYSVKMTRCQAGGDNLNIIPGNGHFSLDV
RAESNILLEELKKKIEHVIESAASMGSKTSYEWMDLAPGAEVSEEAERFMRKGILEVYGE
ERCTGPLYTTGSDDFHYYTVKRPHLKAVMLGLGADLQPGLHHPYMRFDHSCIMDGVEILK
QTVLKVLEDRG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacattagaactacaagagcgcttaacggagatttttcagcatttacacgaaaac
cctgaagtaagttggaaagaatatgaaacgacagcgtatattactgactttttaaaagaa
gaaggaatttcatatagaacatttgatgattgtccaggtgtaattgctgagattggaggc
gggaatccagttattgcgattcgtgctgatatggatgcactttggcaagaagtaaatgga
gaatttaaagcgaaccattcatgtggccatgatgctcatatgaccattgtaatgggactt
attttacaattgaaaaatatgagatggaaaagtggtacggttagatttatttttcagcca
gcagaagagaaggggaatggtgctttgaagatggtggagaaaggtgctgtagatgatgct
gatttcttatttggcgtccatctaagaccaattgaagaactatctttgaaacaagcagcc
ccatctattcgtcatggagcagcaggatttttagagggtatgattcatggggaggatgca
cacggggcaagaccacatcaaggtgtgaatgcaattgatgtcatttccatgattaatatc
ggtttgaaaaatatctggctgccaccgcaaagttcttattcagtaaaaatgacgagatgc
caagctggtggtgataatttaaatattattccgggaaatggtcatttcagtttagatgta
agagcagagagtaatatactattagaagaattaaagaaaaagattgagcatgtaatagaa
tcagctgcatcgatgggatcaaaaacttcatacgaatggatggatcttgcaccaggagca
gaggtttccgaagaagcagagcgctttatgcgtaaaggtattctcgaagtgtatggggaa
gagagatgcacagggcctctctatacgacaggaagcgatgatttccattactatacagtg
aaaagaccacatttaaaagctgtcatgcttggactaggagcagacctacaacctggatta
caccatccgtatatgaggtttgatcatagttgtattatggatggggtagaaatattgaaa
caaactgtattgaaagtgttagaagacaggggctag

DBGET integrated database retrieval system