KEGG   Bacillus cereus ATCC 14579: BC0375Help
Entry
BC0375            CDS       T00127                                 

Definition
(RefSeq) methyltransferase
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_32 Methyltransf_25 Methyltransf_31 Methyltransf_23 MetW CMAS Methyltransf_11 DOT1 DUF1987 MTS TRM13 RrnaAD PCMT Methyltransf_12 Methyltransf_9 TehB Methyltransf_18
Motif
Other DBs
NCBI-GeneID: 1202728
NCBI-ProteinID: NP_830214
UniProt: Q81IL1
Position
356857..357462
Genome map
AA seq 201 aa AA seqDB search
MNEQYYDAVLHIKTVGEQKGFNKSMHYHRYEPTPYSGLDELLNQYEIRSSDRIVDFGCGK
GRLNFYMHHKCGASAVGIEMNEEFYKEAMDNRDRYARKARNSKGKIQFQCCLAQEYEIDP
HDNRFYFFNPFSVQVFMNVVNNILLSVEETGREVDIILYYPSEDYIFFLENQTAFELKKE
VRLSGAYEKNGNERFLVYTLG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattacgatgcagttttacatataaaaacagtcggtgagcaaaaaggg
tttaacaagtctatgcattatcatcgctatgaaccgacaccgtatagcgggttagatgag
ttattgaatcaatatgaaatacgaagtagcgaccgaattgtagactttgggtgcggaaaa
gggcgattaaacttttatatgcatcataaatgtggtgcttcagcagttggaattgaaatg
aatgaagagttttataaagaagcgatggataatcgagatcgttatgcacgaaaggcacga
aacagtaaggggaaaattcaattccaatgttgtttagcgcaggaatatgagattgatcca
catgataataggttttatttctttaatccgttttctgtgcaagtgtttatgaatgtagta
aataacattttgctttcagtagaagaaacggggagagaagtagatattattttatattat
ccttctgaggactatattttcttcttagaaaatcagactgcgtttgagctgaagaaagaa
gttagattgtcaggtgcttatgagaagaatgggaatgagaggtttttagtttatacatta
gggtaa

DBGET integrated database retrieval system