KEGG   Bacillus cereus ATCC 14579: BC0377Help
Entry
BC0377            CDS       T00127                                 

Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bce04147]
    BC0377
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     BC0377
Exosome [BR:bce04147]
 Exosomal proteins
  Proteins found in most exosomes
   BC0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 1202730
NCBI-ProteinID: NP_830216
UniProt: Q81IK9
Position
complement(359038..359601)
Genome map
AA seq 187 aa AA seqDB search
MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYAT
LKDLGVEVYSVSTDTHFTHKAWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAAR
GTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRNNPGEVCPAKWQEGSATLKPS
LDLVGKI
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttattaatcggcacagaagtaaaaccgtttaaagctaatgcttaccataatggagaa
tttatccaagttactgacgaaagtttaaaaggaaaatggagtgtagtttgtttctaccca
gctgacttcacattcgtttgcccaactgaacttgaagacttacaaaaccaatacgcaact
ctaaaagacttaggcgttgaagtatactctgtatctacagacactcacttcactcacaaa
gcatggcatgatagctcagaaactatcggcaaaatcgagtacatcatgattggtgaccca
actcgcacaatcactacaaacttcaacgttttaatggaagaagaaggtcttgctgctcgt
ggtacattcatcatcgatccagacggcgttatccaatctatggaaatcaatgctgacggt
atcggccgtgatgcaagcattcttgttaacaaaattaaagctgctcaatacgtacgtaac
aacccaggtgaagtttgcccagctaaatggcaagagggttctgcaacacttaaaccaagc
cttgaccttgtaggcaaaatctaa

DBGET integrated database retrieval system