KEGG   Bacillus cereus ATCC 14579: BC0383Help
Entry
BC0383            CDS       T00127                                 

Definition
(RefSeq) ferrichrome-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce02010  ABC transporters
Module
bce_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bce00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BC0383
Transporters [BR:bce02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BC0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2
Motif
Other DBs
NCBI-GeneID: 1202736
NCBI-ProteinID: NP_830222
UniProt: Q81IK3
Position
complement(365308..366228)
Genome map
AA seq 306 aa AA seqDB search
MKKLFISLTVLFVLVMSACSNSSTDKKNDAKGSKSETITYQSEDGKKVEVPANPKRVVVL
SSFAGNVMSLGVNLVGVDSWSKQNPRFDSKLKDVAEVSDENVEKIAELNPDLIIGLSNVK
NVDKLKKIAPTVTYTYGKVDYLTQHLEIGKLLNKEKEAKTWVDDFKKRAQEAGKEIKAKI
GEDATVSVVENFNKQLYVYGENWGRGTEILYQEMKLKMPEKVKEKALKEGYYALSTEVLP
EFAGDYLIVSKNKDTDNSFQETESYKNIPAVKNNRVYEANMMEFYFNDPLTLDFQLDFFK
KSFLGK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttatttatttcactaacagtccttttcgttcttgttatgagcgcttgtagc
aatagctctacagacaaaaagaacgatgcaaaaggtagcaaatcagaaacaattacatac
caatctgaagatggtaaaaaagtagaagttcctgcaaatccaaaacgcgttgttgtatta
tcatcattcgctggtaacgtaatgtcattaggtgtaaatcttgttggggtagattcatgg
tctaaacaaaacccacgttttgatagcaaacttaaagatgttgctgaagtatctgatgaa
aatgttgaaaaaatcgctgaactaaatccagatttaatcatcggtttatcaaatgttaaa
aatgtcgataagttaaagaaaatcgcgcctactgtaacatacacttacggaaaagttgat
tacttaacacagcatttagaaatcggtaagttattaaataaagaaaaagaagcaaaaact
tgggttgatgacttcaagaaacgtgcacaagaagctggtaaagaaattaaagcaaaaatc
ggtgaagacgcaacggtttctgttgtagaaaacttcaacaaacagctttatgtatacggc
gagaactggggccgtggaacagaaatcctgtaccaagaaatgaaattaaaaatgcctgaa
aaagtaaaagaaaaagcattaaaagaaggttactacgcattatctactgaggtattacct
gaatttgctggtgattacttaatcgtaagtaaaaacaaagatactgataactcattccaa
gagacagaatcatataaaaacatcccagcagtaaaaaataatcgcgtatatgaagcaaac
atgatggaattctatttcaatgatccacttacattagatttccaactagacttcttcaag
aagagctttcttggtaaataa

DBGET integrated database retrieval system